DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and PCSK2

DIOPT Version :9

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:NP_002585.2 Gene:PCSK2 / 5126 HGNCID:8744 Length:638 Species:Homo sapiens


Alignment Length:478 Identity:92/478 - (19%)
Similarity:160/478 - (33%) Gaps:190/478 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 HGT----HVSSIASGNHSSRDVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMTKVME---LCR 416
            |||    .||:.|:.|...   .|||.|:|:..:.:.|...            ||.::|   :..
Human   208 HGTRCAGEVSAAANNNICG---VGVAYNSKVAGIRMLDQPF------------MTDIIEASSISH 257

  Fly   417 DGRRIDVINMSYGEHANWSNSGRIGEL----MNEVVNK----YGVVWVASAGNHGPALCTVGTPP 473
            ..:.||:.:.|:|...|........||    |.:.|||    .|.::|.::|:.       |:..
Human   258 MPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDG-------GSYD 315

  Fly   474 DISQPSLIGVGAYVSPQMMEAEYAMREKLPGNVYTWT-SRDPCIDGGQGVTV---CAPGGAIASV 534
            |.:      ...|.|..                  || |.:..|:.|:....   |:  ..:||.
Human   316 DCN------CDGYASSM------------------WTISINSAINDGRTALYDESCS--STLAST 354

  Fly   535 --------PQFTMSKSQLM-------NGTSMAAPHVAGAVALLIS---GLKQQNIEYSPYSIKRA 581
                    |:..::.:.|.       :|||.|||..||..||.:.   ||..:::::        
Human   355 FSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQH-------- 411

  Fly   582 ISVTATKLGYV-DPFAQ--------------GHGLLN-------------VEKAFEHL------- 611
            ::|..:|...: |...|              |:|:|:             |.:.|..:       
Human   412 LTVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDP 476

  Fly   612 --------------TEHRQSKDNMLRF--------SVRVGNNADKGIHLRQGVQRNSIDYNVYIE 654
                          |:..:.|:|.:|:        :|......|..|::...:...||       
Human   477 EKIPSTGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSI------- 534

  Fly   655 PIFYNDKEADPK---DKFNF--------------NVRLNLIASQPWVQCGAFLD---LSYGTRSI 699
            .:....::.|.|   ||:.|              .:.|..:.|.|  |.|...:   :.:||:| 
Human   535 LLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP--QKGVLKEWTLMLHGTQS- 596

  Fly   700 AVRVDPTGLQPGVHSAVIRAYDT 722
            |..:|          .|:|.|.:
Human   597 APYID----------QVVRDYQS 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796 57/266 (21%)
Peptidase_S8 331..600 CDD:278510 61/292 (21%)
TPPII 892..1073 CDD:289357
TPPII_N 1144..1257 CDD:289360
PCSK2NP_002585.2 S8_pro-domain 33..109 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 122..418 CDD:173789 57/265 (22%)
Peptidase_S8 158..435 CDD:278510 60/282 (21%)
P_proprotein 504..591 CDD:279782 15/95 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.