DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and Rspo4

DIOPT Version :9

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:XP_006235324.1 Gene:Rspo4 / 499918 RGDID:1563415 Length:228 Species:Rattus norvegicus


Alignment Length:97 Identity:23/97 - (23%)
Similarity:33/97 - (34%) Gaps:30/97 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1040 NYNQCIVGGRKYVSSPLRLSTRVLYIAPITQERLTKANLPAQCAWLSGNLVFPQDEVGRRVAQHP 1104
            :::.||..| |...|...|.|||....|..||.:      |.|..:|.:...|        .:.|
  Rat   146 SWSPCIHNG-KTCGSGWGLETRVREAGPAKQEEM------ASCRVISESRKCP--------IKRP 195

  Fly  1105 FTYILNP---------------AEKKSHTNGS 1121
            .....||               .|::.|.:||
  Rat   196 CPGERNPRQKNRKDRRQRKDRKLERRLHQHGS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796
Peptidase_S8 331..600 CDD:278510
TPPII 892..1073 CDD:289357 12/32 (38%)
TPPII_N 1144..1257 CDD:289360
Rspo4XP_006235324.1 Furin-like_2 35..138 CDD:292535
FU 85..126 CDD:214589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.