DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and amon

DIOPT Version :9

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster


Alignment Length:293 Identity:57/293 - (19%)
Similarity:99/293 - (33%) Gaps:98/293 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 HGTH-VSSIASGNHSSRDVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMTKVMELCRDGRRID 422
            |||. ...:|:...:.....|||.::||..:     |:......|.|:.|.:    :..:..:|.
  Fly   237 HGTRCAGEVAAARDNGICGVGVAYDSKIAGI-----RMLDQPYMTDLIEANS----MGHEPHKIH 292

  Fly   423 VINMSYGEHANWSNSGRIGELMNEVVNKYGVVWVASAGNHGPALCTVGTPPDISQPSLI-GVGAY 486
            :.:.|:|.    ::.|:                            ||..|.:.:..::: ||.  
  Fly   293 IYSASWGP----TDDGK----------------------------TVDGPRNATMRAIVQGVN-- 323

  Fly   487 VSPQMMEAEYAMREKLPGNVYTWTS-----RDPC-----------------IDGGQGV------- 522
                  |....:     ||:|.|.|     .|.|                 |:.||..       
  Fly   324 ------EGRNGL-----GNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDESCS 377

  Fly   523 -TVCAPGGAIASVPQFTMSKSQLM-------NGTSMAAPHVAGAVALLISGLKQQNIEYSPYSIK 579
             |:.:.....|..|...::.:.|.       :|||.|||..||..||.:    :.|.:.:...|:
  Fly   378 STLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALAL----EANPQLTWRDIQ 438

  Fly   580 RAISVTATKLGYVDPFAQGHGLLN-VEKAFEHL 611
            ....:|:.:....|...:.|..:| |...|.||
  Fly   439 HLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHL 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796 50/268 (19%)
Peptidase_S8 331..600 CDD:278510 51/279 (18%)
TPPII 892..1073 CDD:289357
TPPII_N 1144..1257 CDD:289360
amonNP_477318.1 S8_pro-domain 43..122 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 150..446 CDD:173789 50/266 (19%)
Peptidase_S8 187..459 CDD:278510 51/279 (18%)
Peptidases_S8_S53 <409..485 CDD:299169 20/67 (30%)
P_proprotein 534..621 CDD:279782
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.