DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and PCSK9

DIOPT Version :9

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:NP_777596.2 Gene:PCSK9 / 255738 HGNCID:20001 Length:692 Species:Homo sapiens


Alignment Length:460 Identity:113/460 - (24%)
Similarity:166/460 - (36%) Gaps:131/460 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 DENGNIKGLSGNSLKLSPELMALNTDPEKAVRVGL-KSFSDLLPSKVRNNIVAQAKLK-HWDKPH 235
            ||:|:.:.|   .|.|..|...|...||....... :...|  |.::....|...|.: |..:..
Human    33 DEDGDYEEL---VLALRSEEDGLAEAPEHGTTATFHRCAKD--PWRLPGTYVVVLKEETHLSQSE 92

  Fly   236 KTA---TANASR-----KIVE-FESQNPG-----------EASKLPW------DKKILKENLDFE 274
            :||   .|.|:|     ||:. |....||           .|.|||.      |..:..:::.:.
Human    93 RTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWN 157

  Fly   275 LEMLNSYEKVYGDIKTSYDCILFPTADGW----LTIVDTTEQGDLDQALRIGEYSRTHETRNVDD 335
            ||.:.         ...|....:...||.    :.::||:.|.|          .|..|.|    
Human   158 LERIT---------PPRYRADEYQPPDGGSLVEVYLLDTSIQSD----------HREIEGR---- 199

  Fly   336 FLSISVNVHDEGNVLEVVG--------MSSPHGTHVSSIASGNHSSRDVDGVAPNAKIVSMTI-- 390
                 |.|.|..||.|..|        ....||||::.:.||    ||. |||..|.:.|:.:  
Human   200 -----VMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSG----RDA-GVAKGASMRSLRVLN 254

  Fly   391 --GDGRLGSMETGTALVRAMTKVMELCRDGRRIDVINMSYGEHANWSNSGRIGELMNEVVNKY-- 451
              |.|.:.....|...:|....|..:   |..:.::.:          :|....::|....:.  
Human   255 CQGKGTVSGTLIGLEFIRKSQLVQPV---GPLVVLLPL----------AGGYSRVLNAACQRLAR 306

  Fly   452 -GVVWVASAGNHGPALCTVGTPPDISQPSLIGVGAYVSPQMMEAEYAMREKLPGNVYT-WTSRDP 514
             |||.|.:|||.....|...   ..|.|.:|.|||           ...:..|..:.| .|:...
Human   307 AGVVLVTAAGNFRDDACLYS---PASAPEVITVGA-----------TNAQDQPVTLGTLGTNFGR 357

  Fly   515 CIDGGQGVTVCAPGGAI--ASVPQFTMSKSQLMNGTSMAAPHVAGAVALLISG--------LKQQ 569
            |:|      :.|||..|  ||....|...||  :|||.||.||||..|:::|.        |:|:
Human   358 CVD------LFAPGEDIIGASSDCSTCFVSQ--SGTSQAAAHVAGIAAMMLSAEPELTLAELRQR 414

  Fly   570 NIEYS 574
            .|.:|
Human   415 LIHFS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796 113/460 (25%)
Peptidase_S8 331..600 CDD:278510 72/270 (27%)
TPPII 892..1073 CDD:289357
TPPII_N 1144..1257 CDD:289360
PCSK9NP_777596.2 Inhibitor_I9 77..149 CDD:283552 18/71 (25%)
Peptidases_S8_PCSK9_ProteinaseK_like 156..421 CDD:173790 83/332 (25%)
Peptidase_S8 180..422 CDD:278510 78/299 (26%)
C-terminal domain 450..692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.