DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TppII and Rspo4

DIOPT Version :9

Sequence 1:	NP_725252.1	Gene:	TppII / 36444	FlyBaseID:	FBgn0020370	Length:	1441	Species:	Drosophila melanogaster
Sequence 2:	NP_001035779.1	Gene:	Rspo4 / 228770	MGIID:	1924467	Length:	228	Species:	Mus musculus

Alignment Length:	99	Identity:	25/99 - (25%)
Similarity:	32/99 - (32%)	Gaps:	34/99 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly  1040 NYNQCIVGGRKYVSSPLRLSTRVLYIAPITQERLTKANLPAQCAWLSGNLVFPQDEV--GRRVAQ 1102
            :::.||..| |...|...|.|||....|..||.      .|.|..||.:...|...:  |.|
Mouse   146 SWSPCIHNG-KTCGSGWGLETRVREAGPAKQEE------TASCRVLSESRKCPIKRLCPGER--- 200

  Fly  1103 HPFTYILNP---------------AEKKSHTNGS 1121
                   ||               .|::.|..||
Mouse   201 -------NPRQKNRKDRRQRKDRKLERRPHQRGS 227

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TppII	NP_725252.1	Peptidases_S8_Tripeptidyl_Aminopeptidase_II	101..589	CDD:173796
		Peptidase_S8	331..600	CDD:278510
		TPPII	892..1073	CDD:289357	12/32 (38%)
		TPPII_N	1144..1257	CDD:289360
Rspo4	NP_001035779.1	Furin-like_2	35..138	CDD:292535
		FU	85..128
		FU	85..126	CDD:214589
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	193..228		8/45 (18%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1404
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900