DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and Pcsk5

DIOPT Version :9

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:XP_038965620.1 Gene:Pcsk5 / 116548 RGDID:620326 Length:1878 Species:Rattus norvegicus


Alignment Length:614 Identity:122/614 - (19%)
Similarity:206/614 - (33%) Gaps:210/614 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 ASRKIVEFESQNPGEASKLPW-DKKILKENLDFELEMLNSYEKVYGDIK-----------TSYDC 294
            :||....|.|..|    |:.| .::::|:....:.::..:....:.|.|           .::.|
  Rat    88 SSRGTHSFISMEP----KVEWIQQQVVKKRTKRDYDLSRAQSTYFNDPKWPSMWYMHCSDNTHPC 148

  Fly   295 ILFPTADG-W------LTIVDTTEQGDLDQALRIGEYSRTHE--TRNVDDFLSISVNVHDEGNVL 350
            ......:| |      ..||.|.    ||..:     .|||.  .:|.|...|..||    ||.|
  Rat   149 QSDMNIEGAWKRGYTGKNIVVTI----LDDGI-----ERTHPDLMQNYDALASCDVN----GNDL 200

  Fly   351 EVV-----GMSSPHGTH-VSSIASGNHSSRDVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMT 409
            :.:     ...:.|||. ...:|:..::|....|:|.||||..:.:.||.:..|           
  Rat   201 DPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDM----------- 254

  Fly   410 KVMELCRDGRRIDVINMSYG-EHANWSNSGRIGELMNEVVNKYGVVWVASAGNHGPALCTVGTPP 473
                       ::..::||. :|                |:.|...|                .|
  Rat   255 -----------VEAKSVSYNPQH----------------VHIYSASW----------------GP 276

  Fly   474 DISQPSLIGVGAYVSPQMMEAEYAMREKLPGNVYTWTSRDPCIDGGQGVTVCAPGGAIASVPQFT 538
            |....::.| .|.::.|..|....|..:..|:|:.|.|.    :||:....|:..|...|:  :|
  Rat   277 DDDGKTVDG-PAPLTRQAFENGVRMGRRGLGSVFVWASG----NGGRSKDHCSCDGYTNSI--YT 334

  Fly   539 MSKSQLM-------------------------------------------NGTSMAAPHVAGAVA 560
            :|.|...                                           .|||.:||..||.:|
  Rat   335 ISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIA 399

  Fly   561 LLISG---LKQQNIEYSPYSIKRAISVTA-----TKLGYVDPFAQGHGLLNVE----KAFEHLTE 613
            |.:..   |..:::::......||..:.|     ...|:......|.||::.|    :|.:..|.
  Rat   400 LALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTV 464

  Fly   614 HRQ-----SKDNMLRFSVRVGNNADKGIHLRQGVQRNSIDYNVYIEPIFYNDKEADPKDKFNFNV 673
            .:|     |.|..:: ::| .|:|.:.|:...|...|...:..|:|.:........|:       
  Rat   465 PQQHVCVESTDRQIK-TIR-PNSAVRSIYKASGCSDNPNHHVNYLEHVVVRITITHPR------- 520

  Fly   674 RLNLIASQPWVQCGAFLDLSYGTRS--IAVRVDPTGLQP------------GVHSA---VIRAYD 721
            |.:|         ..:|....||||  :|.|:....::.            |..:|   |:..||
  Rat   521 RGDL---------AIYLTSPSGTRSQLLANRLFDHSMEGFKNWEFMTIHCWGERAAGDWVLEVYD 576

  Fly   722 TDCVQK-----GSLFEIPV----TVVQPH 741
            |....:     |.|.|..:    |.|||:
  Rat   577 TPSQLRNFKTPGKLKEWSLVLYGTSVQPY 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796 81/425 (19%)
Peptidase_S8 331..600 CDD:278510 62/326 (19%)
TPPII 892..1073 CDD:289357
TPPII_N 1144..1257 CDD:289360
Pcsk5XP_038965620.1 S8_pro-domain 40..116 CDD:406785 8/31 (26%)
Peptidases_S8_Protein_convertases_Kexins_Fur in-lik 128..422 CDD:173789 70/367 (19%)
P_proprotein 507..597 CDD:396185 20/105 (19%)
GF_recep_IV 637..751 CDD:405525
VSP 674..>1063 CDD:146106
GF_recep_IV 889..995 CDD:405525
VSP 1003..>1324 CDD:146106
VSP 1293..>1618 CDD:146106
FU 1642..1684 CDD:214589
FU 1694..1737 CDD:214589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.