DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and Pcsk9

DIOPT Version :9

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:NP_705793.1 Gene:Pcsk9 / 100102 MGIID:2140260 Length:694 Species:Mus musculus


Alignment Length:413 Identity:99/413 - (23%)
Similarity:156/413 - (37%) Gaps:133/413 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 KAVRVG-----LKSFSDLLPS---KVRNNIVAQA-KLKHWDKPHKTATANASRKIVEF-ESQNPG 255
            :|.|.|     |..|.||.|.   |:.::::..| ||.|                ||: |..:..
Mouse   104 RAARRGYVIKVLHIFYDLFPGFLVKMSSDLLGLALKLPH----------------VEYIEEDSFV 152

  Fly   256 EASKLPWDKKILKENLDFELEMLNSYEKVYGDIKTSYDCILFPTADG----WLTIVDTTEQGDLD 316
            .|..:||       ||:   .::.::.:...|          .:.||    .:.::||:.||   
Mouse   153 FAQSIPW-------NLE---RIIPAWHQTEED----------RSPDGSSQVEVYLLDTSIQG--- 194

  Fly   317 QALRIGEYSRTHETR-NVDDFLSI----SVNVHDEGNVLEVVGMSSPHGTHVSSIASGNHSSRDV 376
                   ..|..|.| .:.||.|:    ....|.:.:..:      .||||::.:.||    ||.
Mouse   195 -------AHREIEGRVTITDFNSVPEEDGTRFHRQASKCD------SHGTHLAGVVSG----RDA 242

  Fly   377 DGVAPNAKIVSMTI----GDGRLGSMETGTALVRAMTKVMELCRDGRRIDVINMSYGEHANWSNS 437
             |||....:.|:.:    |.|.:.....|...:|   |...:...|..:.::.:          :
Mouse   243 -GVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIR---KSQLIQPSGPLVVLLPL----------A 293

  Fly   438 GRIGELMNEV---VNKYGVVWVASAGNHGPALCTVGTPPDISQPSLIGVGAYVSPQMMEAEYAMR 499
            |....::|..   :.:.|||.||:|||.....|...   ..|.|.:|.|||           ...
Mouse   294 GGYSRILNAACRHLARTGVVLVAAAGNFRDDACLYS---PASAPEVITVGA-----------TNA 344

  Fly   500 EKLPGNVYT-WTSRDPCIDGGQGVTVCAPG----GAIASVPQFTMSKSQLMNGTSMAAPHVAGAV 559
            :..|..:.| .|:...|:|      :.|||    ||.:......||:|    |||.||.||||.|
Mouse   345 QDQPVTLGTLGTNFGRCVD------LFAPGKDIIGASSDCSTCFMSQS----GTSQAAAHVAGIV 399

  Fly   560 A--------LLISGLKQQNIEYS 574
            |        |.::.|:|:.|.:|
Mouse   400 ARMLSREPTLTLAELRQRLIHFS 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796 99/413 (24%)
Peptidase_S8 331..600 CDD:278510 69/269 (26%)
TPPII 892..1073 CDD:289357
TPPII_N 1144..1257 CDD:289360
Pcsk9NP_705793.1 Inhibitor_I9 80..152 CDD:283552 16/63 (25%)
Peptidases_S8_PCSK9_ProteinaseK_like 159..424 CDD:173790 81/342 (24%)
Peptidase_S8 183..420 CDD:278510 73/294 (25%)
C-terminal domain. /evidence=ECO:0000250 453..694
Cell attachment site. /evidence=ECO:0000255 499..501
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.