DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and pcsk7

DIOPT Version :9

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:NP_001307357.1 Gene:pcsk7 / 100009656 ZFINID:ZDB-GENE-030131-7293 Length:709 Species:Danio rerio


Alignment Length:345 Identity:73/345 - (21%)
Similarity:119/345 - (34%) Gaps:123/345 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 RNVDDFLSISVNVHDEG---NVLEVVGMSSP------------------------HGTH-VSSIA 367
            ||:.. ..::|.|.|:|   |:.::....||                        |||. ...||
Zfish   145 RNITG-AGVTVVVVDDGIQHNLADIQPNYSPEGSYDLNSNDPDPMPHPDGPSDNHHGTRCAGEIA 208

  Fly   368 SGNHSSRDVDGVAPNAKIVSMTIGDGRL-GSMETGTALVRAMTKVMELCR-----DGRRIDVINM 426
            :.:::|....|||..:::..:.:.||.| .|||............:..|.     |||.:|    
Zfish   209 AVSNNSFCAVGVAYGSRVAGIRVLDGPLTDSMEAIAFNKHYQVNDIYSCSWGPDDDGRTVD---- 269

  Fly   427 SYGEHANWSNSGRIGE--LMNEVV---NKYGVVWVASAGNHGP------------ALCTV----- 469
              |.|.       :|:  |.:.|:   ..:|.:::.::||.|.            ::.||     
Zfish   270 --GPHP-------LGKAALQHGVIAGRKGFGSIFIVASGNGGQNQDNCNYDGYANSIYTVTIGAV 325

  Fly   470 ---GTPPDISQPSLIGVGAYVSPQMMEAEYAMREKLPGN--VYTWTSRDPCIDGGQGVTVCAPGG 529
               |..|..::.         ...|:...::     .||  :.:..:.|..:..|.|   |..| 
Zfish   326 DESGRKPTYAEE---------CASMLAVTFS-----SGNTPLRSIVTSDWSLQSGTG---CTSG- 372

  Fly   530 AIASVPQFTMSKSQLMNGTSMAAPHVAGAVALLISGLKQQNIEYSPYSIKRAISVTATK------ 588
                           ..|||.|||..||.|||::    |.....|...::..|:.|||:      
Zfish   373 ---------------HTGTSAAAPLAAGMVALML----QVRPCLSWRDVQHIITYTATQHDLQAD 418

  Fly   589 -----LGYVDPFAQGHGLLN 603
                 .|:......|.||||
Zfish   419 WVTNGAGFHHSHKYGFGLLN 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796 67/329 (20%)
Peptidase_S8 331..600 CDD:278510 69/340 (20%)
TPPII 892..1073 CDD:289357
TPPII_N 1144..1257 CDD:289360
pcsk7NP_001307357.1 S8_pro-domain 31..112 CDD:318632
Peptidases_S8_Protein_convertases_Kexins_Fur in-lik 116..411 CDD:173789 65/316 (21%)
P_proprotein 494..579 CDD:307572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.