DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and pcsk1

DIOPT Version :9

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:NP_001131134.1 Gene:pcsk1 / 100005716 ZFINID:ZDB-GENE-071009-1 Length:755 Species:Danio rerio


Alignment Length:409 Identity:85/409 - (20%)
Similarity:137/409 - (33%) Gaps:149/409 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 LDQALRIGEYSRTHETRNVDDFLSISVN--------VHDEGNVLEVVGMSSPHGTH-VSSIASGN 370
            ||..|   |::.|....|.|...|...|        .:|..|       .:.|||. ...||...
Zfish   169 LDDGL---EWNHTDIYPNYDPAASYDFNDNDPDPFPRYDSTN-------ENKHGTRCAGEIAMQA 223

  Fly   371 HSSRDVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMTKVMELCRDG---RRIDVINMSYGEHA 432
            .:::...|||.|:|:..:.:.||             .:|..:|....|   ..:|:.:.|:|.:.
Zfish   224 DNNKCGVGVAYNSKVGGIRMLDG-------------IVTDAIEASSIGYNPDHVDIYSASWGPND 275

  Fly   433 NWSNSGRIGELMNEVVNKYGV---------VWVASAGNHG------------PALCTVGTPPDIS 476
            :.......|.|..:.. :||:         ::|.::||.|            .:|.|:    .||
Zfish   276 DGKTVEGPGRLAQKAF-EYGIQKGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSLYTI----SIS 335

  Fly   477 QPSLIGVGAYVSPQMMEAEYAMREKLPGNVYTWTSRDPCIDGGQGVTVCAPGGAIASVPQFTMSK 541
            ..|..|:..:         ||  ||....:.|..|.....|  |.:|                 .
Zfish   336 SASQQGLSPW---------YA--EKCSSTLATAYSSGDYTD--QRIT-----------------S 370

  Fly   542 SQLMN-------GTSMAAPHVAGAVALLISGLKQQNIEYSPYSIKRAISVTATKLGYVDPFAQ-- 597
            :.|.|       |||.:||..||..||.:    :||.:.:...::..:..|:.    .||.|.  
Zfish   371 ADLHNECTETHTGTSASAPLAAGIFALAL----EQNPDLTWRDLQHLVVWTSE----FDPLANNP 427

  Fly   598 ---------------GHGLLNVE--------KAFEHLTEHRQS--KDNMLR---------FSVRV 628
                           |.||||.:        |.::|:.|.:|.  :|...:         .|:.:
Zfish   428 GWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCIVRDETFQPRPLKAAGEISIEI 492

  Fly   629 GNNADKGIHLRQGVQRNSI 647
            ...|..|       |.||:
Zfish   493 PTKACAG-------QANSV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796 66/313 (21%)
Peptidase_S8 331..600 CDD:278510 65/325 (20%)
TPPII 892..1073 CDD:289357
TPPII_N 1144..1257 CDD:289360
pcsk1NP_001131134.1 S8_pro-domain 32..108 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 124..418 CDD:173789 65/310 (21%)
Peptidase_S8 161..435 CDD:278510 69/331 (21%)
P_proprotein 507..594 CDD:279782
Proho_convert 716..752 CDD:288988
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.