DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Src

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_114183.1 Gene:Src / 83805 RGDID:620795 Length:542 Species:Rattus norvegicus


Alignment Length:317 Identity:111/317 - (35%)
Similarity:165/317 - (52%) Gaps:41/317 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PSKVPNNKHI------IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPM 176
            |:..|..:.:      ||.:|:.:..:||.|.||.|..|.| ||..|  ||||.|....|  :|.
  Rat   255 PTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTW-NGTTR--VAIKTLKPGTM--SPE 314

  Fly   177 EFLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFA 241
            .||:||.:|..:.||.:|:||.|| :.:.:.:|||..:..|||:.||  |....:|.:|.|.:.:
  Rat   315 AFLQEAQVMKKLRHEKLVQLYAVV-SEEPIYIVTEYMNKGSLLDFLK--GETGKYLRLPQLVDMS 376

  Fly   242 LQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAW 306
            .||.:||.|:|:...:||||.|.||||......|::||||:|.: ...:|   ......|.||.|
  Rat   377 AQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLI-EDNEY---TARQGAKFPIKW 437

  Fly   307 CAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEY 371
            .|||...|.|||..||||:||:.|.|:.:.|..|:..:...::|:.::. .| |:..|..||...
  Rat   438 TAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER-GY-RMPCPPECPESL 500

  Fly   372 YTLMMKCWQDDAAKRPRFGEIYDQLPDMKPEQLKAVV----NCTEPKKDHLLYRQGD 424
            :.||.:||:.:..:||.|            |.|:|.:    ..|||:     |:.|:
  Rat   501 HDLMCQCWRKEPEERPTF------------EYLQAFLEDYFTSTEPQ-----YQPGE 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 98/262 (37%)
PTKc_Ack_like 137..398 CDD:270636 98/260 (38%)
SH3 400..454 CDD:214620 8/29 (28%)
CRIB 486..525 CDD:238077
SrcNP_114183.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
SH3_Src 88..149 CDD:212941
SH2_Src_Src 153..253 CDD:198228
PTKc_Src 266..542 CDD:270656 109/306 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.