DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Frk

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_077344.1 Gene:Frk / 79209 RGDID:621423 Length:506 Species:Rattus norvegicus


Alignment Length:272 Identity:108/272 - (39%)
Similarity:168/272 - (61%) Gaps:12/272 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHEN 192
            |..:||.:.|:||:|:||.|.:|:|:|   ...||:|.|....|  :|.:||:||.||.|:.|..
  Rat   230 IDRNSIQLLKRLGSGQFGEVWEGLWNN---TTPVAVKTLKPGSM--DPNDFLREAQIMKSLRHPK 289

  Fly   193 IVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLI 257
            :::||.|....|.:.::|||....||.|.|::.|  .|.:.:....:.|.|:.:||.|||.:..|
  Rat   290 LIQLYAVCTLEDPIYIITELMRHGSLQEYLQNDG--GSKIRLTQQVDMAAQVASGMAYLESQNYI 352

  Fly   258 HRDLAARNILVFSKDKVKISDFGLSRALGV-GKDYYKTNFNVNLKLPIAWCAPECINYLRFTNAS 321
            ||||||||:||...:..|::||||:|...| .:|.|::...:  |||:.|.|||.|...:|:..|
  Rat   353 HRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESKHEI--KLPVKWTAPEAIRTNKFSIKS 415

  Fly   322 DVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKR 386
            |||:||:.|:|:.:||..|::.:||.|::..: ..|| ||.||..||.::|::||:||..:..:|
  Rat   416 DVWSFGILLYEIITYGKMPYSGMTGAQVIHML-GQNY-RLPQPSNCPEQFYSIMMECWNVEPKQR 478

  Fly   387 PRFGEIYDQLPD 398
            |.|..::.:|.|
  Rat   479 PTFETLHWKLED 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 104/263 (40%)
PTKc_Ack_like 137..398 CDD:270636 104/261 (40%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
FrkNP_077344.1 SH3_Src_like 48..105 CDD:212779
SH2_Src_Frk 113..208 CDD:199831
PTKc_Frk_like 226..495 CDD:270653 108/272 (40%)
Pkinase_Tyr 235..488 CDD:285015 104/263 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.