DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Fgr

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_077059.2 Gene:Fgr / 79113 RGDID:621319 Length:517 Species:Rattus norvegicus


Alignment Length:297 Identity:109/297 - (36%)
Similarity:158/297 - (53%) Gaps:27/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHEN 192
            |..:||:::::||||.||.|..|.|   |...:||:|.|....|  :|..||:||.||..:.|:.
  Rat   246 IDRNSIALDRRLGTGCFGDVWLGTW---NCSTKVAVKTLKPGTM--SPKAFLEEAQIMKLLRHDK 305

  Fly   193 IVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLI 257
            :|:||.|| :.:.:.:|||.....|||:.|||.  :...|.:|.|.:.|.|:..||.|:|:...|
  Rat   306 LVQLYAVV-SEEPIYIVTEFMCYGSLLDFLKDR--KGHNLMLPNLVDMAAQVAEGMAYMERMNYI 367

  Fly   258 HRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASD 322
            ||||.|.||||......||:||||:|.: |..:|   |.....|.||.|.|||...:.|||..||
  Rat   368 HRDLRAANILVGEHLICKIADFGLARLI-VDDEY---NPQQGTKFPIKWTAPEAALFGRFTVKSD 428

  Fly   323 VWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRP 387
            ||:||:.|.|:.:.|..|:..:...::||.::  :...:..|..||...|.:|.:.|:.|..:||
  Rat   429 VWSFGILLTELITKGRVPYPGMNNREVLEQVE--HGYHMPCPPGCPVSLYEVMEQTWRLDPEERP 491

  Fly   388 RFGEIYDQLPDMKPEQLKAVVNCTEPKKDHLLYRQGD 424
            .|..:...|.|        ....|||:     |:.||
  Rat   492 TFEYLQSFLED--------YFTSTEPQ-----YQPGD 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 99/262 (38%)
PTKc_Ack_like 137..398 CDD:270636 99/260 (38%)
SH3 400..454 CDD:214620 6/25 (24%)
CRIB 486..525 CDD:238077
FgrNP_077059.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..46
SH3 68..125 CDD:418401
SH2_Src_Fgr 128..228 CDD:198230
PKc_like 255..502 CDD:419665 99/260 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.