DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and ptk6b

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001070140.1 Gene:ptk6b / 767734 ZFINID:ZDB-GENE-060929-1150 Length:511 Species:Danio rerio


Alignment Length:407 Identity:120/407 - (29%)
Similarity:190/407 - (46%) Gaps:66/407 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTESELQQYYNAVKNELKITNAAQFKYAADEDLRFIGLSRPEIRRLRKFYE-----KHFPHSYLS 71
            ::||:...|..:|:.:   .||..||.....|..::.       .|.||..     :|:....||
Zfish   162 VSESDDMGYVLSVRTK---ENAKHFKIFQTGDQFYVD-------ALFKFSSIVEVIEHYQSHPLS 216

  Fly    72 KIKRLLQAPGTMVKREEAPGGGSQVALDGSSASACSSLAAKNGASSPSKVPNNKHIIPADSISVN 136
             |..||..|...:|.|..|                          .||   .::..:|.:...:.
Zfish   217 -IGDLLSEPCIRIKPENVP--------------------------PPS---TDEWELPKEEFQLE 251

  Fly   137 KQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNP----MEFLKEAAIMHSIEHENIVRLY 197
            .|||:|.|..|..|.|.|.:   :||||.|     ::|.    .||..|..||..:.|::::.|:
Zfish   252 NQLGSGHFADVYSGKWKNHS---KVAIKIL-----KNNDALVLREFQLEVQIMKRLRHKHLISLF 308

  Fly   198 GVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDLA 262
            .|..::....::|||.....||..|::...|  .|.:.:|.:.|.|:.:||.|||....||||||
Zfish   309 AVCTSSSPFYIITELIEKGDLLHFLRNPEGR--SLQMESLIDMAAQVADGMAYLEANNSIHRDLA 371

  Fly   263 ARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFG 327
            |||:||......||:||||:|.  :.:..|.::   :.|:|..|.|||.|.:..:::.||||:||
Zfish   372 ARNVLVGDGYVCKIADFGLARI--IKEPVYLSD---DKKIPYKWTAPEAIGHGTYSSKSDVWSFG 431

  Fly   328 VCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEI 392
            :.|:|:.::|..|:..:...::.:.|...|| |:..|..||...|.:|..||:.::..||.|..:
Zfish   432 ILLYEIVTHGGIPYPGVNTGEVYDLITKENY-RMPSPPKCPQAIYNIMRACWRIESVDRPNFKVL 495

  Fly   393 YDQLPDMKPEQLKAVVN 409
            .|:| |....|..:|.|
Zfish   496 KDEL-DNYQGQYSSVGN 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 12/57 (21%)
STYKc 133..396 CDD:214568 90/266 (34%)
PTKc_Ack_like 137..398 CDD:270636 91/264 (34%)
SH3 400..454 CDD:214620 3/10 (30%)
CRIB 486..525 CDD:238077
ptk6bNP_001070140.1 SH3_Brk 70..126 CDD:212781
SH2 132..216 CDD:214585 13/63 (21%)
PTKc_Srm_Brk 241..502 CDD:133248 93/277 (34%)
STYKc 250..499 CDD:214568 90/264 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.