DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and YES1

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_005424.1 Gene:YES1 / 7525 HGNCID:12841 Length:543 Species:Homo sapiens


Alignment Length:297 Identity:111/297 - (37%)
Similarity:154/297 - (51%) Gaps:27/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHEN 192
            ||.:|:.:..:||.|.||.|..|.| ||..:  ||||.|....|.  |..||:||.||..:.|:.
Human   272 IPRESLRLEVKLGQGCFGEVWMGTW-NGTTK--VAIKTLKPGTMM--PEAFLQEAQIMKKLRHDK 331

  Fly   193 IVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLI 257
            :|.||.|| :.:.:.:|||.....|||:.||:...:  :|.:|.|.:.|.||.:||.|:|:...|
Human   332 LVPLYAVV-SEEPIYIVTEFMSKGSLLDFLKEGDGK--YLKLPQLVDMAAQIADGMAYIERMNYI 393

  Fly   258 HRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASD 322
            ||||.|.||||......||:||||:|.: ...:|   ......|.||.|.|||...|.|||..||
Human   394 HRDLRAANILVGENLVCKIADFGLARLI-EDNEY---TARQGAKFPIKWTAPEAALYGRFTIKSD 454

  Fly   323 VWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRP 387
            ||:||:...|:.:.|..|:..:...::||.::. .| |:..|..||...:.||..||:.|..:||
Human   455 VWSFGILQTELVTKGRVPYPGMVNREVLEQVER-GY-RMPCPQGCPESLHELMNLCWKKDPDERP 517

  Fly   388 RFGEIYDQLPDMKPEQLKAVVNCTEPKKDHLLYRQGD 424
            .|..|...|.|        ....|||:     |:.|:
Human   518 TFEYIQSFLED--------YFTATEPQ-----YQPGE 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 101/262 (39%)
PTKc_Ack_like 137..398 CDD:270636 102/260 (39%)
SH3 400..454 CDD:214620 5/25 (20%)
CRIB 486..525 CDD:238077
YES1NP_005424.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
SH3_Yes 94..151 CDD:212940
SH2_Src_family 154..253 CDD:199827
PTKc_Yes 264..542 CDD:270654 111/297 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.