DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and SYK

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001167638.1 Gene:SYK / 6850 HGNCID:11491 Length:635 Species:Homo sapiens


Alignment Length:278 Identity:104/278 - (37%)
Similarity:160/278 - (57%) Gaps:18/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PSKVPNNKHIIPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPM---EFL 179
            |.:|..::.::..:    :|:||:|.||.|::|.:........||:|.|..|  .::|.   |.|
Human   360 PKEVYLDRKLLTLE----DKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNE--ANDPALKDELL 418

  Fly   180 KEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQI 244
            .||.:|..:::..|||:.|:..| :|.|||.|:|.|..|.:.|:.:    ..:....:.|...|:
Human   419 AEANVMQQLDNPYIVRMIGICEA-ESWMLVMEMAELGPLNKYLQQN----RHVKDKNIIELVHQV 478

  Fly   245 CNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAP 309
            ..||:|||:...:||||||||:|:.::...||||||||:||...::|||.  ..:.|.|:.|.||
Human   479 SMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKA--QTHGKWPVKWYAP 541

  Fly   310 ECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTL 374
            |||||.:|::.||||:|||.:||.||||.:|:..:.|.::...::  ..:|:..|..||.|.|.|
Human   542 ECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLE--KGERMGCPAGCPREMYDL 604

  Fly   375 MMKCWQDDAAKRPRFGEI 392
            |..||..|...||.|..:
Human   605 MNLCWTYDVENRPGFAAV 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 102/263 (39%)
PTKc_Ack_like 137..398 CDD:270636 102/259 (39%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
SYKNP_001167638.1 SH2_N-SH2_Zap70_Syk_like 13..116 CDD:198191
Interdomain A 108..167
SH2_C-SH2_Syk_like 164..262 CDD:198264
Interdomain B 260..370 2/9 (22%)
PTKc_Syk 375..631 CDD:133247 102/259 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.