DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and fynb

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001025140.1 Gene:fynb / 574422 ZFINID:ZDB-GENE-050706-89 Length:544 Species:Danio rerio


Alignment Length:301 Identity:116/301 - (38%)
Similarity:165/301 - (54%) Gaps:35/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHEN 192
            ||.:|:.:.|:||.|:||.|..|.| |||.:  ||||.|....|  :|..||:||.||..:.|:.
Zfish   273 IPRESLQLIKRLGNGQFGEVWMGTW-NGNTK--VAIKTLKPGTM--SPESFLEEAQIMKKLRHDK 332

  Fly   193 IVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLI 257
            :|:||.|| :.:.:.:|||.....|||:.|||...|.  |.:|.|.:.|.|:..||.|:|:...|
Zfish   333 LVQLYAVV-SEEPIYIVTEYMGKGSLLDFLKDGEGRA--LKLPNLVDMAAQVAGGMAYIERMNYI 394

  Fly   258 HRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASD 322
            ||||.:.||||......||:||||:|.: ...:|   ......|.||.|.|||...|.:||..||
Zfish   395 HRDLRSANILVGDSLVCKIADFGLARLI-EDNEY---TARQGAKFPIKWTAPEAALYGKFTIKSD 455

  Fly   323 VWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRP 387
            ||:||:.|.|:.:.|..|:..:...::||.::. .| |::.|..|||..:.||::||:.||.:||
Zfish   456 VWSFGILLTELVTKGRVPYPGMNNREVLEQVER-GY-RMQCPQDCPSSLHELMVQCWKKDAEERP 518

  Fly   388 RFGEIYDQLPDMKPEQLKAVV----NCTEPKKDHLLYRQGD 424
            .|            |.|:|.:    ..|||:     |:.||
Zfish   519 TF------------EYLQAFLEDYFTATEPQ-----YQPGD 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 104/262 (40%)
PTKc_Ack_like 137..398 CDD:270636 104/260 (40%)
SH3 400..454 CDD:214620 9/29 (31%)
CRIB 486..525 CDD:238077
fynbNP_001025140.1 SH3_Fyn_Yrk 92..147 CDD:212939
SH2_Src_Fyn_isoform_a_like 152..252 CDD:198281
PKc_like 268..541 CDD:304357 114/298 (38%)
Pkinase_Tyr 278..527 CDD:285015 107/274 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.