DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and blk

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_017208000.1 Gene:blk / 567764 ZFINID:ZDB-GENE-040724-106 Length:501 Species:Danio rerio


Alignment Length:478 Identity:147/478 - (30%)
Similarity:218/478 - (45%) Gaps:118/478 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QYYNAVKNELKITNAAQ-------------------FKYAADEDLRFIGLSRPEI---------- 54
            ::||:..:  |.::|::                   |:.|::.||:|....|..|          
Zfish    31 EHYNSTNS--KTSHASRDHKKQNNNQDEDVVIAQYDFQPASENDLQFKKGDRLRIIKENGEWWLA 93

  Fly    55 RRLRKFYEKHFPHSYLSK------------------IKRLLQAPGT-----MVK----------- 85
            :.|...||...|.:|:::                  .:|||.|||.     :|:           
Zfish    94 KSLVTGYEGFIPSTYVARAQTLQVERWFFKDMNRRDTERLLLAPGNKPGSFLVRESETTKGAFSL 158

  Fly    86 --REEAPGGGSQV------ALDG-----SSASACSS--------------LAAKNGASSPSKVP- 122
              |:..|..|..|      |||.     |.:::.||              |..:.|....|..| 
Zfish   159 SIRDSTPEQGDVVKHYKIRALDNGGYYISPSTSFSSLQELVKYYSRTADGLCQRLGNPCKSTAPQ 223

  Fly   123 ----NNKHIIPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAA 183
                .::..||.:::.:.|:||.|:||.|..|.:.|..   :||||.|....|:  |..||:||.
Zfish   224 RPWAQDEWEIPRETLKLVKKLGAGQFGEVWMGFYKNNQ---KVAIKTLKEGTME--PEAFLQEAN 283

  Fly   184 IMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLK-DSGLRVSFLTIPTLCEFALQICNG 247
            :|..::||.:|:|:.|| ..:.:.:|||.....|||:.|| |.|.:   |.:..|.:...||..|
Zfish   284 LMKQLQHERLVKLHAVV-TREPIYIVTEYMANGSLLDFLKTDDGHK---LKLSKLIDMTAQIAEG 344

  Fly   248 MRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNV--NLKLPIAWCAPE 310
            |.|:|:|..|||||.|.||||......||:||||:|.:       :|.:..  ..|.||.|.|||
Zfish   345 MAYIERKNYIHRDLRAANILVSETLHCKIADFGLARII-------ETEYTAQEGAKFPIKWTAPE 402

  Fly   311 CINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLM 375
            .|||..||..||||:||:.|.|:.:||..|:..:|..:::..:|. || |:..||.||.|.|.:|
Zfish   403 AINYGTFTIKSDVWSFGILLTEIVTYGRVPYPGMTNPEVIRNLDR-NY-RMPCPDACPGELYDIM 465

  Fly   376 MKCWQDDAAKRPRFGEIYDQLPD 398
            .|||.:....||.|..:.|.|.|
Zfish   466 TKCWMEKPEDRPTFEYLQDTLND 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 14/74 (19%)
STYKc 133..396 CDD:214568 106/265 (40%)
PTKc_Ack_like 137..398 CDD:270636 107/263 (41%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
blkXP_017208000.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.