DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and map3k7

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_009292938.1 Gene:map3k7 / 553788 ZFINID:ZDB-GENE-041001-135 Length:578 Species:Danio rerio


Alignment Length:512 Identity:131/512 - (25%)
Similarity:202/512 - (39%) Gaps:117/512 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 ISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHENIVRLY 197
            |.|.:.:|.|.||:|.:..|...:    ||||.:   ..:|....|:.|...:..::|.|||:||
Zfish    25 IEVEEVVGRGAFGVVCKAKWKGRD----VAIKTI---ESESEKNAFIVELRQLSRVDHPNIVKLY 82

  Fly   198 GVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYL---EQKRLIHR 259
            |  ...:.:.||.|.|...||...|..:. .:...|......:.||...|:.||   :.|.||||
Zfish    83 G--SCNNPVCLVMEYAEGGSLYNVLHGAE-PLPHYTASHAMSWCLQCSQGVSYLHGMKPKALIHR 144

  Fly   260 DLAARNILVFSKDKV-KISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDV 323
            ||...|:|:.:...| ||.|||.:..:       :|:. .|.|...||.|||......::...||
Zfish   145 DLKPPNLLLVAGGTVLKICDFGTACDI-------QTHM-TNNKGSAAWMAPEVFEGSNYSEKCDV 201

  Fly   324 WAFGVCLWEMFSYGFQPWAALTG--LQILEAIDAPNYQRLEQPDC---CPSEYYTLMMKCWQDDA 383
            :::|:.|||:.:.. :|:..:.|  .:|:.|:     .|..:|..   .|....:||.:||..|.
Zfish   202 FSWGIILWEVITRR-KPFDEIGGPAFRIMWAV-----HRGTRPPLIKNLPKAIESLMTRCWSKDP 260

  Fly   384 AKRPRFGEIYDQLPDM------KPEQLK--------AVVNCTEPKKDHLLY----RQGDIISVLD 430
            ::||...||...:..:      ..|.||        ...|.......||.|    .:.||.....
Zfish   261 SQRPSMEEIVKIMSHLMGYFPGSEEPLKYPYQYSDEGQSNSATSTGSHLDYTCTSNKNDINMEHT 325

  Fly   431 RNTGT------PFW-KGV----LSTGKTGYFNPSNTVAFLEGLPSSTRDSFSRVSDHR-----IS 479
            .:.|:      |:. ||:    ||.|.:           :|.||.  |..|...||.:     :|
Zfish   326 NSPGSNDTIKFPYKPKGISGQSLSRGSS-----------VESLPG--RSHFQPSSDSKRMSVELS 377

  Fly   480 KRKLRTEMISKPQNDFKHTGHVGIDGATFGDIAFLGSSQNYNHVPKQIVT----PYKPSEDIEQT 540
            :.:.|....|..:..:|. ||  ...|:.|.|.         .:||.|||    |:: ...::..
Zfish   378 ELEPRLPFASPARPQYKR-GH--RKTASHGTIL---------DIPKIIVTATCEPHR-RRSVQDL 429

  Fly   541 PLLLPPTPTSPDSLQTASGYFPEGANSGGAMGTSMNPTFIPSAEHTPKLIATNGQSS 597
            |.:  .|..|.||...:               .|.:|:|   ...||....|||..:
Zfish   430 PAI--GTDASQDSRNNS---------------RSSSPSF---RMITPDRTDTNGSDN 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 80/271 (30%)
PTKc_Ack_like 137..398 CDD:270636 78/269 (29%)
SH3 400..454 CDD:214620 16/76 (21%)
CRIB 486..525 CDD:238077 7/38 (18%)
map3k7XP_009292938.1 TyrKc 25..273 CDD:197581 80/271 (30%)
STKc_TAK1 31..281 CDD:270960 78/273 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.