DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and hck

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001015722.1 Gene:hck / 548439 XenbaseID:XB-GENE-6048191 Length:498 Species:Xenopus tropicalis


Alignment Length:303 Identity:115/303 - (37%)
Similarity:165/303 - (54%) Gaps:20/303 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GSSASACSSLAAKNGASSPSKVPNNKHI--IPADSISVNKQLGTGEFGIVQQGVW-SNGNERIQV 161
            |..:..|..|........|.| |..|..  ||.:|:|:.|:||||:||    .|| :..|...:|
 Frog   199 GKMSGLCQCLTVPCQTLRPEK-PWEKDAWEIPRESLSLQKKLGTGQFG----DVWLATYNGHTEV 258

  Fly   162 AIKCLCRERMQSNPMEFLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKD-S 225
            |:|.:....|  :|..||:||.:|.|::||.:|||:.||...:.:.:|||..|..|||:.||. .
 Frog   259 AVKTMKAGSM--SPAAFLEEANLMKSLQHERLVRLHAVVTQGEPIYIVTEYMHKGSLLDFLKSPE 321

  Fly   226 GLRVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKD 290
            |.|   ..:..|.:|..||..||.::||:..|||||.|.|.||......||:||||:|.: ...:
 Frog   322 GSR---QPVTQLIDFCAQIAEGMWFIEQRNYIHRDLRAANCLVSETLLCKIADFGLARVI-EDSE 382

  Fly   291 YYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDA 355
            |   ......|.||.|.:||..||..||..||:|:|||.|.|:.:||..|:..::..:::.|::.
 Frog   383 Y---TAREGSKFPIKWTSPEAANYGSFTIKSDIWSFGVLLSEIMTYGRSPYPGMSNSEVMAALER 444

  Fly   356 PNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEIYDQLPD 398
             .| |:..|..||:|.|.:|::|||.|..|||.|..:.:.|.|
 Frog   445 -GY-RMPCPGTCPTELYGIMLQCWQQDPHKRPTFEYLQNILED 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 103/264 (39%)
PTKc_Ack_like 137..398 CDD:270636 103/262 (39%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
hckNP_001015722.1 SH3 57..112 CDD:388381
SH2_Src_family 115..211 CDD:199827 3/11 (27%)
PTKc_Src_like 237..484 CDD:270630 102/261 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.