DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and mst1r

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001008091.1 Gene:mst1r / 493453 XenbaseID:XB-GENE-480211 Length:216 Species:Xenopus tropicalis


Alignment Length:66 Identity:20/66 - (30%)
Similarity:29/66 - (43%) Gaps:13/66 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 QLPDMKPEQLKA---VVNCTEPKKDHLLYRQGDIISVLDRNTGTPFWKGVLSTGKTGYFNPSNTV 456
            |:.|:|.|..:.   |::.|.||     |:..|:..:..:|..|.|     .|.|.....||.||
 Frog    17 QVGDVKTEISRPGVYVIDVTFPK-----YQPVDVEEITFKNYYTAF-----LTVKIQQKRPSETV 71

  Fly   457 A 457
            |
 Frog    72 A 72

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938