DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and NTRK3

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_016877743.1 Gene:NTRK3 / 4916 HGNCID:8033 Length:850 Species:Homo sapiens


Alignment Length:393 Identity:121/393 - (30%)
Similarity:176/393 - (44%) Gaps:95/393 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ADEDLRFIGLSR-PEIRR---LRKFYEKHFPHSYLSKIKRLLQAPGTMVKREEAPGGGSQVALDG 100
            |..|...||::| |.|..   .|:.:..|.|.:|:..|||    ...::|||...|...:|.|  
Human   496 AGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKR----RDIVLKRELGEGAFGKVFL-- 554

  Fly   101 SSASACSSLAAKNGASSPSKVPNNKHIIPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKC 165
               :.|.:|       ||:|                                    :::.||:|.
Human   555 ---AECYNL-------SPTK------------------------------------DKMLVAVKA 573

  Fly   166 LCRERMQSNPMEFLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVS 230
            | ::...:...:|.:||.::.:::||:||:.|||....|.|::|.|......|.:.|:..|....
Human   574 L-KDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAM 637

  Fly   231 FLT------------IPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSR 283
            .|.            :..:...|.||.:||.||..:..:|||||.||.||.:...|||.|||:||
Human   638 ILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSR 702

  Fly   284 ALGVGKDYY------KTNFNV-----------------NLKLPIAWCAPECINYLRFTNASDVWA 325
            .: ...|||      |..|:|                 :..|||.|..||.|.|.:||..||||:
Human   703 DV-YSTDYYREGPCQKGPFSVVWQRQRLAATAASTVGGHTMLPIRWMPPESIMYRKFTTESDVWS 766

  Fly   326 FGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFG 390
            |||.|||:|:||.|||..|:..:::|.|.....  ||:|..||.|.|.:|:.|||.:..:|....
Human   767 FGVILWEIFTYGKQPWFQLSNTEVIECITQGRV--LERPRVCPKEVYDVMLGCWQREPQQRLNIK 829

  Fly   391 EIY 393
            |||
Human   830 EIY 832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 8/28 (29%)
STYKc 133..396 CDD:214568 96/296 (32%)
PTKc_Ack_like 137..398 CDD:270636 96/292 (33%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
NTRK3XP_016877743.1 LRR_8 103..160 CDD:290566
leucine-rich repeat 105..128 CDD:275378
leucine-rich repeat 129..151 CDD:275378
leucine-rich repeat 152..164 CDD:275378
TPKR_C2 163..208 CDD:293525
Ig_TrkABC_d4 211..301 CDD:143173
IG_like 218..301 CDD:214653
Ig_TrKABC_d5 319..396 CDD:143172
PTKc_TrkC 532..843 CDD:270676 110/357 (31%)
TyrKc 538..835 CDD:197581 107/347 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.