DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and lyn

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001004543.1 Gene:lyn / 447804 ZFINID:ZDB-GENE-040912-7 Length:510 Species:Danio rerio


Alignment Length:320 Identity:115/320 - (35%)
Similarity:169/320 - (52%) Gaps:29/320 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 TMVKREEAPGGGSQVALDGSSASACSSLAAKNGASSPSKVPNNKHI--IPADSISVNKQLGTGEF 144
            :|:|.......|....||    .||....|:.        |.:|..  |..|||.:.|:||.|:|
Zfish   204 SMIKHYHKQSDGLCRKLD----KACEKPKAQK--------PWDKDAWEISKDSIKMVKKLGAGQF 256

  Fly   145 GIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHENIVRLYGVVLATDSLMLV 209
            |.|....::|..   :||:|.|....|...  .||:||.:|.:::|:.:||||.||..|:.:.::
Zfish   257 GEVWMAFYNNST---KVAVKTLKPGTMSVE--AFLEEANLMKTLQHDRLVRLYAVVTKTEPIYII 316

  Fly   210 TELAHLRSLLECLK-DSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDK 273
            ||.....|||:.|| .:|.::.   :|.|.:|:.||..||.|:|:|..|||||.|.|:||.....
Zfish   317 TEYMANGSLLDFLKSQAGSKIQ---LPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSEMLL 378

  Fly   274 VKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGF 338
            .||:||||:|.  :..|.|..  ....|.||.|.|||.|||..||..||:|:|||.|:|:.:||.
Zfish   379 CKIADFGLARV--IEDDQYTA--REGAKFPIKWTAPEAINYGSFTIKSDMWSFGVLLYEIITYGK 439

  Fly   339 QPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEIYDQLPD 398
            .|:..::..:::.::.. .| |:.:|:.||.|.|.:|..||::....||.|..|...|.|
Zfish   440 IPYPGMSNSEVMSSVQR-GY-RMPRPENCPVELYEIMTTCWKNKPEDRPTFDYIQSVLDD 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 100/263 (38%)
PTKc_Ack_like 137..398 CDD:270636 100/261 (38%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
lynNP_001004543.1 SH3_Lyn 65..120 CDD:212937
SH2_Src_Lyn 123..223 CDD:198227 5/22 (23%)
PTKc_Lyn 237..508 CDD:270657 105/275 (38%)
Pkinase_Tyr 245..495 CDD:285015 100/263 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.