DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Csk

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001262476.1 Gene:Csk / 41398 FlyBaseID:FBgn0262081 Length:1052 Species:Drosophila melanogaster


Alignment Length:266 Identity:99/266 - (37%)
Similarity:157/266 - (59%) Gaps:19/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 IIPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHE 191
            :||...:.:.:.:|.||||.|..|:..|.    :||:|.|   :.:....:||.||::|.::||:
  Fly   794 VIPEAELQLRESIGKGEFGDVMLGILRNE----KVAVKML---KDEGAVQKFLAEASVMTTLEHD 851

  Fly   192 NIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRL 256
            |:|:..|:|..:..|.||||.....||::.|:..|.:  .:|......||....:||.|||.|::
  Fly   852 NLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQ--HITKKDQIIFAYDTASGMEYLEAKKV 914

  Fly   257 IHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNAS 321
            :||||||||:|:......|:|||||:|     ::.|  |.:|. ||||.|.|||.:...||:|.|
  Fly   915 VHRDLAARNVLISEDCVAKVSDFGLAR-----EECY--NLDVG-KLPIKWTAPEALKNGRFSNKS 971

  Fly   322 DVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKR 386
            |:|:||:.|||::|:|..|:..:....:::.::. .| ::|.|:.||.|.|.:|.:.|..:.|||
  Fly   972 DMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEV-GY-KMEAPEGCPPEIYEMMRQAWDLNPAKR 1034

  Fly   387 PRFGEI 392
            |.|.|:
  Fly  1035 PTFAEL 1040

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 97/260 (37%)
PTKc_Ack_like 137..398 CDD:270636 97/256 (38%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
CskNP_001262476.1 SH2_csk_like 680..777 CDD:198190
PTKc_Csk_like 793..1047 CDD:270635 99/266 (37%)
STYKc 800..1044 CDD:214568 97/260 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.