DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and FER

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster


Alignment Length:373 Identity:118/373 - (31%)
Similarity:182/373 - (48%) Gaps:49/373 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RKFYEKHFPHSYL--SKIKRLLQAPGTMVKREEAPGGGSQVAL---------------------- 98
            |..||:.:.|..|  .::.|||...|..:.||......||:.|                      
  Fly   953 RPLYEEEWFHGVLPREEVVRLLNNDGDFLVRETIRNEESQIVLSVCWNGHKHFIVQTTGEGNFRF 1017

  Fly    99 DGSSASACSSL-----------AAKNGASSPSKVPNNKHIIPADSISVNKQLGTGEFGIVQQGVW 152
            :|...::...|           ..|:||.....|...:..:..|.:.:.:::|.|.||.|.:...
  Fly  1018 EGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKL 1082

  Fly   153 SNGNERIQVAIKCLCRERM-QSNPMEFLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLR 216
            .  :.::.||:| .||..: .....:||:|..|:...:|.|||:|.|:.:....:|:|.||....
  Fly  1083 K--STKLDVAVK-TCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGG 1144

  Fly   217 SLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGL 281
            |||..|:.:...::......:|..|   ..||||||.|..|||||||||.||..:..|||||||:
  Fly  1145 SLLTYLRKNSNGLTTRQQMGMCRDA---AAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGM 1206

  Fly   282 SRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTG 346
            ||.    ::.|..:..:. ::|:.|.|||.:|:.::|:..|||::|:.:||:||.|..|::.:|.
  Fly  1207 SRE----EEEYIVSDGMK-QIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTN 1266

  Fly   347 LQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEIYD 394
            .:..|.||. .| |:..|...|.|.|.||::||..||..||.|.|||:
  Fly  1267 SRARERIDT-GY-RMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYN 1312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 3/6 (50%)
STYKc 133..396 CDD:214568 97/263 (37%)
PTKc_Ack_like 137..398 CDD:270636 97/259 (37%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 16/85 (19%)
TyrKc 1063..1311 CDD:197581 95/260 (37%)
PTKc_Fes_like 1067..1315 CDD:270637 97/259 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.