DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and LYN

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_011515831.1 Gene:LYN / 4067 HGNCID:6735 Length:682 Species:Homo sapiens


Alignment Length:350 Identity:122/350 - (34%)
Similarity:178/350 - (50%) Gaps:55/350 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PEIRRLRKFYEKHFPHSYLSKIKRLLQAPGTMVKREEAPGGGSQVALDGSSASACSSLAAKNGAS 116
            |.|..:.|.|:|              ||.|...:.|:                ||.|       .
Human   372 PCISDMIKHYQK--------------QADGLCRRLEK----------------ACIS-------P 399

  Fly   117 SPSKVPNNKHI--IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFL 179
            .|.| |.:|..  ||.:||.:.|:||.|:||.|..|.::|..   :||:|.|....|  :...||
Human   400 KPQK-PWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNST---KVAVKTLKPGTM--SVQAFL 458

  Fly   180 KEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLK-DSGLRVSFLTIPTLCEFALQ 243
            :||.:|.:::|:.:||||.||...:.:.::||.....|||:.|| |.|.:|   .:|.|.:|:.|
Human   459 EEANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKV---LLPKLIDFSAQ 520

  Fly   244 ICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCA 308
            |..||.|:|:|..|||||.|.|:||......||:||||:|.: ...:|   ......|.||.|.|
Human   521 IAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVI-EDNEY---TAREGAKFPIKWTA 581

  Fly   309 PECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYT 373
            ||.||:..||..||||:||:.|:|:.:||..|:...|...::.|: :..| |:.:.:.||.|.|.
Human   582 PEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTAL-SQGY-RMPRVENCPDELYD 644

  Fly   374 LMMKCWQDDAAKRPRFGEIYDQLPD 398
            :|..||::.|.:||.|..:...|.|
Human   645 IMKMCWKEKAEERPTFDYLQSVLDD 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 5/12 (42%)
STYKc 133..396 CDD:214568 101/263 (38%)
PTKc_Ack_like 137..398 CDD:270636 101/261 (39%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
LYNXP_011515831.1 SH3_Lyn 237..292 CDD:212937
SH2_Src_Lyn 295..395 CDD:198227 9/52 (17%)
PTKc_Lyn 409..680 CDD:270657 105/274 (38%)
Pkinase_Tyr 417..667 CDD:285015 101/263 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.