DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and btl

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster


Alignment Length:401 Identity:119/401 - (29%)
Similarity:174/401 - (43%) Gaps:91/401 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IRRLRKFYEK------HFPHSYLSKIKRLLQAPGTMVKREEAPGGGSQVALDGSSASACSS---- 108
            :||||:  ||      ...|.:..|:  ::..||                  |...|.|||    
  Fly   625 LRRLRR--EKLLKLRIETVHQWTKKV--IIYRPG------------------GEEGSGCSSGDLQ 667

  Fly   109 -------------LAAKNGASSPSKVPNNKHI-------IPADSISVNKQLGTGEFGIVQQGVWS 153
                         .....|.:.|::..|....       ||...:|:...||.|.||.|.... :
  Fly   668 MPVIRIEKQRTTVSTTGTGGTDPAQGFNEYEFPLDSNWEIPRQQLSLGSILGEGAFGRVVMAE-A 731

  Fly   154 NGNERIQ------VAIKCLCRERMQSNPMEFLKEAAIMHSI-EHENIVRLYGVVLATDSLMLVTE 211
            .|..|..      ||:|.:..|...::....::|..:|..| :|.||:.|.|.......|.::.|
  Fly   732 EGLPRSPQLAETIVAVKMVKEEHTDTDMASLVREMEVMKMIGKHINIINLLGCCSQGGPLWVIVE 796

  Fly   212 LAHLRSLLECLK-----------DSG--------LRVSFLTIPTLCEFALQICNGMRYLEQKRLI 257
            .|...:|.:.||           ||.        :....|....|.:||.||..||.||..:|.|
  Fly   797 YAPHGNLKDFLKQNRPGAPQRRSDSDGYLDDKPLISTQHLGEKELTKFAFQIARGMEYLASRRCI 861

  Fly   258 HRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASD 322
            ||||||||:||.....:||:||||:|.: ...:||:.  |.|.:|||.|.|||.:...::.:.||
  Fly   862 HRDLAARNVLVSDGYVMKIADFGLARDI-QDTEYYRK--NTNGRLPIKWMAPESLQEKKYDSQSD 923

  Fly   323 VWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNY----QRLEQPDCCPSEYYTLMMKCWQDDA 383
            ||::||.|||:.:||.||:.     .||.|.:..:|    ||:|:|..|....|.:|.:||..::
  Fly   924 VWSYGVLLWEIMTYGDQPYP-----HILSAEELYSYLITGQRMEKPAKCSLNIYVVMRQCWHFES 983

  Fly   384 AKRPRFGEIYD 394
            ..||.|.|:.:
  Fly   984 CARPTFAELVE 994

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 6/16 (38%)
STYKc 133..396 CDD:214568 99/292 (34%)
PTKc_Ack_like 137..398 CDD:270636 98/288 (34%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652
Ig 258..340 CDD:143165
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653
Ig 507..583 CDD:299845
PKc_like 700..1000 CDD:304357 101/304 (33%)
TyrKc 712..996 CDD:197581 99/292 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.