DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and uqcrfs1

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_988911.1 Gene:uqcrfs1 / 394506 XenbaseID:XB-GENE-5746219 Length:273 Species:Xenopus tropicalis


Alignment Length:183 Identity:45/183 - (24%)
Similarity:75/183 - (40%) Gaps:40/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SLAAKNGASSPSKVPNNKHIIPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIK--CLCRER 170
            |||.::|:.:|        .:.|.|.:|..||.....|:|.|.      :::.:.:|  .||||.
 Frog     3 SLATRSGSVAP--------YLSATSYAVAGQLKPLVSGVVLQA------DKVLLDVKKPFLCRES 53

  Fly   171 MQSN-PMEFLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLR--SLLECLK----DSGLR 228
            :... |...|..:|   .|.....||.    |.:|  :.|.:.:..|  .:|:..|    .|..|
 Frog    54 LNGQAPNGGLSASA---GINGAACVRF----LHSD--VTVPDFSDYRRPEVLDSTKSSQTSSDSR 109

  Fly   229 VSF---LTIPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISD 278
            .||   :|..|....|....|.:     .:.:....|:.::|..||.::|:||
 Frog   110 KSFSYLVTGVTAVATAYAAKNAV-----TQFVTSMSASADVLAMSKIEIKLSD 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 38/158 (24%)
PTKc_Ack_like 137..398 CDD:270636 37/154 (24%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
uqcrfs1NP_988911.1 Ubiq-Cytc-red_N 2..76 CDD:370333 22/89 (25%)
UCR_TM 79..144 CDD:367251 14/71 (20%)
Rieske_cytochrome_bc1 150..273 CDD:239552 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.