DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and egfra

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_919405.1 Gene:egfra / 378478 ZFINID:ZDB-GENE-030918-1 Length:1191 Species:Danio rerio


Alignment Length:557 Identity:154/557 - (27%)
Similarity:241/557 - (43%) Gaps:121/557 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SPS-KVPNNK--HIIPADSISVNKQLGTGEFGIVQQGVW--SNGNERIQVAIKCLCRERMQSNPM 176
            :|| :.||..  .|:........|.||:|.||.|.:|:|  ...|.:|.||||.|..........
Zfish   692 TPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVHKGLWVPEGENVKIPVAIKVLREATSPKANK 756

  Fly   177 EFLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFA 241
            |.:.||.:|.|:||.::.||.|:.| |.::.|:|:|.....||:.::::..|:....:...|   
Zfish   757 EIMDEAYVMASVEHPHVCRLLGICL-TSTVQLITQLMPYGCLLDYVRENKDRIGSQHLLNWC--- 817

  Fly   242 LQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAW 306
            :||..||.|||::.|:||||||||:||.:...|||:||||::.|...:..|..:..   |:||.|
Zfish   818 VQIAKGMNYLEERHLVHRDLAARNVLVKTPQHVKITDFGLAKLLNADEKEYHADGG---KVPIKW 879

  Fly   307 CAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEY 371
            .|.|.|.:..:|:.||||::||.:||:.::|.:|:..:...:|...::  ..:||.||..|..:.
Zfish   880 MALESIQHRTYTHQSDVWSYGVTVWELMTFGTKPYDGIPASEIAGVLE--KGERLPQPPICTIDV 942

  Fly   372 YTLMMKCWQDDAAKRPRFGEIYDQLPDMKPEQLKAVVNCTEPKKDHLLYRQGDIISVLDRNTGTP 436
            |.:|:|||..||..||||.|:..:...|          ..:|.:  .|..|||....|...:.:.
Zfish   943 YMIMVKCWMIDAESRPRFRELIAEFTKM----------ARDPSR--YLVIQGDDRMHLPSPSDSK 995

  Fly   437 FWKGVLS------TGKTGYFNPSNTVAFLEGLPSSTRDSFSRVSDHRISKRKLRTEMISKPQNDF 495
            |::.::|      .....|..|::  :|... ||::|....    |.:|.               
Zfish   996 FYRSLMSGELDEAVDADEYLVPNH--SFFSS-PSTSRTQLL----HSVSL--------------- 1038

  Fly   496 KHTGHVGIDGATFGDIAFLGSSQNYNHVPKQIVTPYKPSEDIEQTPLLLP--PTPT---SPDSLQ 555
                     .::||:.    :|:|.|..|            :.:..::|.  |.||   .....|
Zfish  1039 ---------NSSFGNC----NSRNGNGYP------------VRENSMVLRYIPDPTERFQEGDFQ 1078

  Fly   556 TASGYFPEGANSGGAMGTSMNPTFIPSAEHTPKLIATNGQSSFD---------FASG-------- 603
            .|.|| .|..|...:  :.:||.:  ...|.|.....:...:.|         |.|.        
Zfish  1079 PAPGY-NEYMNQNES--SMINPVY--QQPHGPPRTLLHSSPALDETEEEYLNCFKSPAPASVVEY 1138

  Fly   604 ---------STNPFF----PNRGDD--ELEFGLHNYG 625
                     ||.|||    |:...|  .||...|..|
Zfish  1139 LNTSHTQLLSTKPFFSMDNPDYQQDFCPLELKTHTNG 1175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 98/264 (37%)
PTKc_Ack_like 137..398 CDD:270636 98/262 (37%)
SH3 400..454 CDD:214620 10/59 (17%)
CRIB 486..525 CDD:238077 5/38 (13%)
egfraNP_919405.1 Recep_L_domain 54..166 CDD:279382
Furin-like 184..333 CDD:279142
FU 229..274 CDD:238021
Recep_L_domain 359..479 CDD:279382
GF_recep_IV 503..634 CDD:291509
FU 550..596 CDD:214589
PTKc_EGFR 703..1014 CDD:270683 108/331 (33%)
Pkinase_Tyr 711..967 CDD:285015 98/264 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.