DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and fyna

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001315092.1 Gene:fyna / 373872 ZFINID:ZDB-GENE-030903-5 Length:537 Species:Danio rerio


Alignment Length:304 Identity:115/304 - (37%)
Similarity:164/304 - (53%) Gaps:41/304 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHEN 192
            ||.:|:.:.|:||.|:||.|..|.| |||.:  ||:|.|....|  :|..||:||.||..:.|:.
Zfish   266 IPRESLQLIKRLGNGQFGEVWMGTW-NGNTK--VAVKTLKPGTM--SPESFLEEAQIMKKLRHDK 325

  Fly   193 IVRLYGVVLATDSLMLVTELAHLRSLLECLKDS---GLRVSFLTIPTLCEFALQICNGMRYLEQK 254
            :|:||.|| :.:.:.:|||.....|||:.|||.   ||:     :|.|.:.|.|:..||.|:|:.
Zfish   326 LVQLYAVV-SEEPIYIVTEYMSKGSLLDFLKDGEGRGLK-----LPNLVDMAAQVAAGMAYIERM 384

  Fly   255 RLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTN 319
            ..|||||.:.||||......||:||||:|.: ...:|   ......|.||.|.|||...|.|||.
Zfish   385 NYIHRDLRSANILVGDSLVCKIADFGLARLI-EDNEY---TARQGAKFPIKWTAPEAALYGRFTI 445

  Fly   320 ASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAA 384
            .||||:||:.|.|:.:.|..|:..:...::||.::. .| |:..|..|||..:.||::||:.|..
Zfish   446 KSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVER-GY-RMPCPQDCPSSLHELMLQCWKRDPE 508

  Fly   385 KRPRFGEIYDQLPDMKPEQLKAVV----NCTEPKKDHLLYRQGD 424
            :||.|            |.|:|.:    ..|||:     |:.||
Zfish   509 ERPTF------------EYLQAFLEDYFTATEPQ-----YQPGD 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 103/265 (39%)
PTKc_Ack_like 137..398 CDD:270636 103/263 (39%)
SH3 400..454 CDD:214620 9/29 (31%)
CRIB 486..525 CDD:238077
fynaNP_001315092.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..34
SH3_Fyn_Yrk 85..140 CDD:212939
SH2_Src_Fyn_isoform_a_like 145..245 CDD:198281
PTKc_Fyn 261..534 CDD:270655 113/301 (38%)
Pkinase_Tyr 271..520 CDD:285015 106/277 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.