DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Ror

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster


Alignment Length:274 Identity:105/274 - (38%)
Similarity:148/274 - (54%) Gaps:11/274 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 KQLGTGEFGIVQQGVWSNGNE-RIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHENIVRLYGVV 200
            ::||.|.||.|.:|.....|: .|.||||.|..........:|.:|..::..::|:|||.:.|||
  Fly   414 EELGEGAFGKVYKGQLLQPNKTTITVAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGVV 478

  Fly   201 LATDSLMLVTELAHLRSLLECL-KDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDLAAR 264
            |..:...::.|......|.|.| .:|......|:.....:.||||..||:||.....:|||||||
  Fly   479 LNKEPYCMLFEYMANGDLHEFLISNSPTEGKSLSQLEFLQIALQISEGMQYLSAHHYVHRDLAAR 543

  Fly   265 NILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLK--LPIAWCAPECINYLRFTNASDVWAFG 327
            |.||.....||||||||||.: ...|||:    |..|  ||:.|...|.|.|.:||..||||:||
  Fly   544 NCLVNEGLVVKISDFGLSRDI-YSSDYYR----VQSKSLLPVRWMPSESILYGKFTTESDVWSFG 603

  Fly   328 VCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEI 392
            |.|||::|||.||:...:..:::..|  .:.|.|..|:.||:..|:||::||.:.:.|||.|.:|
  Fly   604 VVLWEIYSYGMQPYYGFSNQEVINLI--RSRQLLSAPENCPTAVYSLMIECWHEQSVKRPTFTDI 666

  Fly   393 YDQLPDMKPEQLKA 406
            .::|........||
  Fly   667 SNRLKTW
HEGHFKA 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 102/262 (39%)
PTKc_Ack_like 137..398 CDD:270636 103/264 (39%)
SH3 400..454 CDD:214620 2/7 (29%)
CRIB 486..525 CDD:238077
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527
PTKc_Ror 404..673 CDD:270642 103/265 (39%)
Pkinase_Tyr 410..670 CDD:285015 102/262 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.