DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and src

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_017209008.1 Gene:src / 325084 ZFINID:ZDB-GENE-030131-3809 Length:549 Species:Danio rerio


Alignment Length:298 Identity:111/298 - (37%)
Similarity:158/298 - (53%) Gaps:29/298 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHEN 192
            ||.||:.::.:||.|.||.|..|.| ||..|  ||||.|....|  :|..||:||.:|..:.||.
Zfish   278 IPRDSLRLDVKLGQGCFGEVWMGTW-NGTTR--VAIKTLKPGTM--SPEAFLQEAQVMKKLRHEK 337

  Fly   193 IVRLYGVVLATDSLMLVTELAHLRSLLECLK-DSGLRVSFLTIPTLCEFALQICNGMRYLEQKRL 256
            :|:||.|| :.:.:.:|||.....|||:.|| |.|   ..|.:|.|.:.|.||.:||.|:|:...
Zfish   338 LVQLYAVV-SEEPIYIVTEYMGQGSLLDFLKGDMG---KMLRLPQLVDMASQIASGMAYVERMNY 398

  Fly   257 IHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNAS 321
            :||||.|.||||......|::||||:|.: ...:|   ......|.||.|.|||...|.|||..|
Zfish   399 VHRDLRAANILVGDNLVCKVADFGLARLI-EDNEY---TARQGAKFPIKWTAPEAALYGRFTIKS 459

  Fly   322 DVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKR 386
            |||:||:.|.|:.:.|..|:..:...::|:.::. .| |:..|..||...:.||:.||:.:..:|
Zfish   460 DVWSFGILLTELTTKGRVPYPGMVNREVLDQVER-GY-RMPCPAECPDSLHELMLTCWRKEPEER 522

  Fly   387 PRFGEIYDQLPDMKPEQLKAVVNCTEPKKDHLLYRQGD 424
            |.|..:...|.|        ....|||:     |:.|:
Zfish   523 PTFEYLQGFLED--------YFTSTEPQ-----YQPGE 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 100/263 (38%)
PTKc_Ack_like 137..398 CDD:270636 101/261 (39%)
SH3 400..454 CDD:214620 5/25 (20%)
CRIB 486..525 CDD:238077
srcXP_017209008.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.