DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Epha1

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_008761105.1 Gene:Epha1 / 312279 RGDID:1304680 Length:1010 Species:Rattus norvegicus


Alignment Length:308 Identity:106/308 - (34%)
Similarity:152/308 - (49%) Gaps:38/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VNKQLGTGEFGIVQQGVWSNGNERIQ-VAIKCLCRERMQSNPMEFLKEAAIMHSIEHENIVRLYG 198
            |:..:|.||||.|.:|.....::..: ||||.|...........||:||.||....|.:|:||.|
  Rat   627 VDTVIGEGEFGEVYRGALRIPSQDCKTVAIKTLKDTSPDGYWWNFLREATIMGQFNHPHILRLEG 691

  Fly   199 VVLATDSLMLVTELAHLRSLLECLK----DSGLR--------VSFLTIPTLCEFA---------- 241
            |:.....:|::||.....:|...||    :...|        ||....|.:..||          
  Rat   692 VITKRKPIMIITEFMENGALDAFLKVRPAEGQFRRGHTLESHVSQTFHPLIYTFALLQEREDQLV 756

  Fly   242 --------LQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNV 298
                    |.|.:||.||.....:|||||||||||......|:|||||:|.|......|:|... 
  Rat   757 PGQLVAMLLGIASGMNYLSGHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGTYETQGG- 820

  Fly   299 NLKLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQ 363
              |:||.|.|||.|.:..||.|||||:||:.:||:.|:|.:|:..::..:::::|:  :..||..
  Rat   821 --KIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIE--DGYRLPP 881

  Fly   364 PDCCPSEYYTLMMKCWQDDAAKRPRFGEIYDQLPDM--KPEQLKAVVN 409
            |..||:..|.||..||..|.|:||.|.::...|..:  .|..|:.:.|
  Rat   882 PVDCPAPLYELMKNCWAYDRARRPHFLQLQAHLEQLL
TDPHSLRTIAN 929

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 102/291 (35%)
PTKc_Ack_like 137..398 CDD:270636 102/291 (35%)
SH3 400..454 CDD:214620 3/10 (30%)
CRIB 486..525 CDD:238077
Epha1XP_008761105.1 EphR_LBD_A1 28..204 CDD:198447
TNFRSF 252..>320 CDD:304602
CRD2 281..312 CDD:276900
fn3 335..426 CDD:278470
FN3 454..536 CDD:238020
EphA2_TM <597..620 CDD:291255
PKc_like 620..918 CDD:304357 103/295 (35%)
Pkinase_Tyr 625..914 CDD:285015 102/291 (35%)
SAM 945..1010 CDD:197735
SAM_EPH-A1 946..1008 CDD:188941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.