DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and HCK

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_002101.2 Gene:HCK / 3055 HGNCID:4840 Length:526 Species:Homo sapiens


Alignment Length:446 Identity:135/446 - (30%)
Similarity:207/446 - (46%) Gaps:98/446 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AQFKYAA--DEDLRF------IGLSRP----EIRRLRKFYEKHFPHSYLSKI------------- 73
            |.:.|.|  .|||.|      :.|...    :.|.|....|.:.|.:|::::             
Human    85 ALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGI 149

  Fly    74 -----KRLLQAPGTMV------------------KREEAPGGGSQV------ALDG--------- 100
                 :|.|.|||.|:                  .|:..|..|..|      .||.         
Human   150 SRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRS 214

  Fly   101 --------------SSASACSSLAAKNGASSPSKVPNNKHI--IPADSISVNKQLGTGEFGIVQQ 149
                          .:...|..|:....:|.|.| |..|..  ||.:|:.:.|:||.|:||.|..
Human   215 TFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQK-PWEKDAWEIPRESLKLEKKLGAGQFGEVWM 278

  Fly   150 GVWSNGNERIQVAIKCLCRERMQSNPME-FLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELA 213
            ..:   |:..:||:|.:   :..|..:| ||.||.:|.:::|:.:|:|:.|| ..:.:.::||..
Human   279 ATY---NKHTKVAVKTM---KPGSMSVEAFLAEANVMKTLQHDKLVKLHAVV-TKEPIYIITEFM 336

  Fly   214 HLRSLLECLK-DSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKIS 277
            ...|||:.|| |.|   |...:|.|.:|:.||..||.::||:..|||||.|.||||.:....||:
Human   337 AKGSLLDFLKSDEG---SKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIA 398

  Fly   278 DFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWA 342
            ||||:|.: ...:|   ......|.||.|.|||.||:..||..||||:||:.|.|:.:||..|:.
Human   399 DFGLARVI-EDNEY---TAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYP 459

  Fly   343 ALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEIYDQLPD 398
            .::..:::.|::. .| |:.:|:.||.|.|.:||:||::...:||.|..|...|.|
Human   460 GMSNPEVIRALER-GY-RMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDD 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 11/42 (26%)
STYKc 133..396 CDD:214568 98/264 (37%)
PTKc_Ack_like 137..398 CDD:270636 99/262 (38%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
HCKNP_002101.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SH3 82..137 CDD:302595 13/51 (25%)
SH2_Src_HCK 140..243 CDD:198226 14/102 (14%)
PKc_like 254..524 CDD:304357 103/276 (37%)
Pkinase_Tyr 262..511 CDD:285015 98/264 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.