DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Txk

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001019426.1 Gene:Txk / 305311 RGDID:1306481 Length:526 Species:Rattus norvegicus


Alignment Length:416 Identity:126/416 - (30%)
Similarity:197/416 - (47%) Gaps:62/416 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTESELQQYYNAVKNELKITNAAQFKYAADE------DLRFIGLSRPEI-RRLRKFYEKHFPHSY 69
            ||..|..::|:  ||..:.......:..|.|      |.|.:|.....: .|.|:..:....|..
  Rat   141 LTNLETYEWYH--KNITRDQTERLLRQEAKEGAFIVRDSRHLGSYTISVFTRARRHTQSSIKHYQ 203

  Fly    70 LSK----------------IKRLLQ-----APGTMVKREEAPGGGSQVALDGSSASACSSLAAKN 113
            :.|                :..|:|     |.|.| .|...|     |.|.||...|.|..:.:.
  Rat   204 IKKNDSGQWYVTERHLFPSVPELIQYHQYNAAGLM-SRLRYP-----VGLLGSCLPATSGFSYEK 262

  Fly   114 GASSPSKVPNNKHIIPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEF 178
            ....||:            ::..|::|:|:||:|..|.|   ..||:||||.:....|...  :|
  Rat   263 WEIDPSE------------LTFVKEIGSGQFGVVYLGEW---RARIRVAIKAINEGSMSEE--DF 310

  Fly   179 LKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQ 243
            ::||.:|..:.|..:|:||||.:....|.:|||......||:.|::...::....:.::|:   .
  Rat   311 IEEAKVMMKLSHSRLVQLYGVCIQQKPLYIVTEFMENGCLLDYLRERKGKLPKALLLSMCQ---D 372

  Fly   244 ICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCA 308
            ||.||.|||:...|||||||||.||.|...|||||||::|.: :..:|..::   ..|.|:.|..
  Rat   373 ICEGMAYLEKSCYIHRDLAARNCLVSSACVVKISDFGMARYV-LDDEYISSS---GAKFPVKWSP 433

  Fly   309 PECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYT 373
            ||..::.::::.||||:|||.:||:|:.|..|:...:.||::|||.  ...||.:|...|...|.
  Rat   434 PEVFHFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS--KGFRLYRPHLAPMSIYG 496

  Fly   374 LMMKCWQDDAAKRPRFGEIYDQLPDM 399
            :|..||.:....||.|.|:...|.::
  Rat   497 VMYSCWHESPKGRPTFAELLQVLAEI 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 13/59 (22%)
STYKc 133..396 CDD:214568 95/262 (36%)
PTKc_Ack_like 137..398 CDD:270636 96/260 (37%)
SH3 400..454 CDD:214620 126/416 (30%)
CRIB 486..525 CDD:238077
TxkNP_001019426.1 SH3_TXK 84..138 CDD:212840
SH2_Tec_Txk 142..247 CDD:198261 22/112 (20%)
PKc_like 265..520 CDD:304357 97/280 (35%)
Pkinase_Tyr 270..519 CDD:285015 95/262 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.