DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Zap70

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_006244823.1 Gene:Zap70 / 301348 RGDID:3983 Length:638 Species:Rattus norvegicus


Alignment Length:278 Identity:111/278 - (39%)
Similarity:165/278 - (59%) Gaps:15/278 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SSPSKVPNNKHIIPADSISV-NKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFL 179
            |.|.::.:.|..:..:::.| :.:||.|.||.|:|||:....::|.||||.|.:...:::..|.:
  Rat   339 SDPEELKDKKLFLKRENLLVADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQSTEKADKDEMM 403

  Fly   180 KEAAIMHSIEHENIVRLYGVVLATDSLMLVTELA---HLRSLLECLKDSGLRVSFLTIPTLCEFA 241
            :||.|||.:::..||||.||..| ::||||.|:|   .|...|...|:.      :.:..:.|..
  Rat   404 REAQIMHQLDNPYIVRLIGVCQA-EALMLVMEMAGGGPLHKFLIGKKEE------IPVSNVAELL 461

  Fly   242 LQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAW 306
            .|:..||:|||:|..:||||||||:|:.::...||||||||:|||....||......  |.|:.|
  Rat   462 HQVAMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAG--KWPLKW 524

  Fly   307 CAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEY 371
            .||||||:.:|::.||||::||.:||.||||.:|:..:.|.::|:.|  ...:|:|.|..||.|.
  Rat   525 YAPECINFRKFSSRSDVWSYGVTMWEAFSYGQKPYKKMKGPEVLDFI--KQGKRMECPPECPPEM 587

  Fly   372 YTLMMKCWQDDAAKRPRF 389
            |.||..||......||.|
  Rat   588 YALMSDCWIYKWEDRPDF 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 108/261 (41%)
PTKc_Ack_like 137..398 CDD:270636 107/256 (42%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
Zap70XP_006244823.1 SH2_N-SH2_Zap70_Syk_like 32..135 CDD:198191
SH2 176..280 CDD:301589
PTKc_Zap-70 352..620 CDD:270686 108/265 (41%)
Pkinase_Tyr 362..612 CDD:285015 107/255 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.