DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Srms

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001011961.1 Gene:Srms / 296472 RGDID:1306602 Length:507 Species:Rattus norvegicus


Alignment Length:401 Identity:119/401 - (29%)
Similarity:190/401 - (47%) Gaps:80/401 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ADEDLRFIGLSRPEIRRLRKFYEKHFPHSYLSKIKRLLQAPGT-MVKREEAPGGGSQVALDGSSA 103
            :|:...|.|:||.:.::|           .||.    ..|||. :::..|:..||..::: .:.|
  Rat   131 SDQPWYFNGISRTQAQQL-----------LLSP----ANAPGAFLIRPSESSIGGYSLSV-RAQA 179

  Fly   104 SAC---------SSLAAKNGASSPS------------KVPNNKHIIPA---------------DS 132
            ..|         ..|..:.|...||            |:..|..:.|.               ..
  Rat   180 KVCHYRICMAPSGGLYLQEGRLFPSLDALLAYYKTNWKLIQNPLLQPCVPQMPLAQDEWERPRSE 244

  Fly   133 ISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHENIVRLY 197
            ..:.::||.|.||.|.:|:|....   .||:|.:....|:.  .:..||...:.|:.||.::||:
  Rat   245 FVLRRKLGEGFFGEVWEGLWLGST---PVAVKVIKSADMKL--ADLTKEIEALKSLRHERLIRLH 304

  Fly   198 GVVLATDSLMLVTELAHLRSLLECLKDSGLRV-------SFLTIPTLCEFALQICNGMRYLEQKR 255
            .:....:.:.:||||         :....|:|       ..|::|.|..||.|:..||.|||::|
  Rat   305 AICSLGEPVYIVTEL---------MGKGNLQVYLGSPEGKALSLPHLLGFACQVAEGMSYLEERR 360

  Fly   256 LIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNA 320
            ::||||||||:||......|::||||:|.|  ..|.|..  :...|:|:.|.|||..||..|:..
  Rat   361 VVHRDLAARNVLVGDDLTCKVADFGLARLL--KDDVYSP--SSGSKIPVKWTAPEAANYRVFSQK 421

  Fly   321 SDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAK 385
            ||||:||:.|:|:|:||..|:..:|..:.|:.| :..| ||.:|..||:|.|.||::||:....:
  Rat   422 SDVWSFGILLYEVFTYGQCPYEGMTNHETLQQI-SRGY-RLPRPAVCPAEVYMLMVECWKGSPEE 484

  Fly   386 RPRFGEIYDQL 396
            ||.|..:.::|
  Rat   485 RPTFATLREKL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 6/24 (25%)
STYKc 133..396 CDD:214568 95/269 (35%)
PTKc_Ack_like 137..398 CDD:270636 96/267 (36%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
SrmsNP_001011961.1 SH3 70..124 CDD:302595
SH2 134..212 CDD:301589 19/93 (20%)
PTKc_Srm_Brk 238..498 CDD:133248 96/278 (35%)
Pkinase_Tyr 245..495 CDD:285015 95/269 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.