DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Syk

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_036890.2 Gene:Syk / 25155 RGDID:3796 Length:629 Species:Rattus norvegicus


Alignment Length:278 Identity:103/278 - (37%)
Similarity:159/278 - (57%) Gaps:18/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PSKVPNNKHIIPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPM---EFL 179
            |.:|..::.::..:    :.:||:|.||.|::|.:........||:|.|..|  .::|.   |.|
  Rat   354 PKEVYLDRKLLTLE----DNELGSGNFGTVKKGYYQMKKVVKTVAVKILKNE--ANDPALKDELL 412

  Fly   180 KEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQI 244
            .||.:|..:::..|||:.|:..| :|.|||.|:|.|..|.:.|:.:    ..:....:.|...|:
  Rat   413 AEANVMQQLDNPYIVRMIGICEA-ESWMLVMEMAELGPLNKYLQQN----RHIKDKNIIELVHQV 472

  Fly   245 CNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAP 309
            ..||:|||:...:||||||||:|:.::...||||||||:||...::|||.  ..:.|.|:.|.||
  Rat   473 SMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKA--QTHGKWPVKWYAP 535

  Fly   310 ECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTL 374
            |||||.:|::.||||:|||.:||.||||.:|:..:.|.::...::  ..:|:..|..||.|.|.|
  Rat   536 ECINYFKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLE--KGERMGCPPGCPREMYDL 598

  Fly   375 MMKCWQDDAAKRPRFGEI 392
            |..||..|...||.|..:
  Rat   599 MNLCWTYDVENRPGFAAV 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 101/263 (38%)
PTKc_Ack_like 137..398 CDD:270636 101/259 (39%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
SykNP_036890.2 SH2_N-SH2_Zap70_Syk_like 12..115 CDD:198191
Interdomain A. /evidence=ECO:0000250 107..166
SH2_C-SH2_Syk_like 163..261 CDD:198264
Interdomain B. /evidence=ECO:0000250 259..364 2/9 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..330
PTKc_Syk 370..625 CDD:133247 101/258 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.