DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Ephb1

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001097998.1 Gene:Ephb1 / 24338 RGDID:2556 Length:984 Species:Rattus norvegicus


Alignment Length:301 Identity:118/301 - (39%)
Similarity:164/301 - (54%) Gaps:16/301 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IPADSISVNKQLGTGEFGIVQQG-VWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHE 191
            |....:.:.:.:|.||||.|.:| :...|...|.||||.|.....:....:||.||:||...:|.
  Rat   614 IDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHP 678

  Fly   192 NIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVS--FLTIPTLCEFALQICNGMRYLEQK 254
            ||:||.|||..:..:|::||.....:|     ||.||.:  ..|:..|......|..||:||.:.
  Rat   679 NIIRLEGVVTKSRPVMIITEFMENGAL-----DSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEM 738

  Fly   255 RLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNL--KLPIAWCAPECINYLRF 317
            ..:|||||||||||.|....|:|||||||.|  ..|.....:..:|  |:|:.|.|||.|.|.:|
  Rat   739 NYVHRDLAARNILVNSNLVCKVSDFGLSRYL--QDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKF 801

  Fly   318 TNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDD 382
            |:|||||::|:.:||:.|:|.:|:..::...::.||: .:| ||..|..||:..:.||:.|||.|
  Rat   802 TSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIE-QDY-RLPPPMDCPAALHQLMLDCWQKD 864

  Fly   383 AAKRPRFGEIYDQLPDM--KPEQLKAVVNCTEPKKDHLLYR 421
            ...||||.||.:.|..|  .|..||.|...|......||.|
  Rat   865 RNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDR 905

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 107/267 (40%)
PTKc_Ack_like 137..398 CDD:270636 108/265 (41%)
SH3 400..454 CDD:214620 8/22 (36%)
CRIB 486..525 CDD:238077
Ephb1NP_001097998.1 EphR_LBD_B1 20..195 CDD:198444
fn3 326..412 CDD:394996
fn3 435..518 CDD:394996
EphA2_TM 542..616 CDD:405290 1/1 (100%)
PTKc_EphR_B 614..882 CDD:173638 109/276 (39%)
SAM_EPH-B1 908..975 CDD:188950
PDZ-binding. /evidence=ECO:0000255 982..984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.