DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and FES

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001996.1 Gene:FES / 2242 HGNCID:3657 Length:822 Species:Homo sapiens


Alignment Length:341 Identity:122/341 - (35%)
Similarity:170/341 - (49%) Gaps:27/341 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KHFPHSYLSKIKRLLQAPGTMVKREEAPGGGSQVALDGSSASACSSLAAKNGASSPSKVPNNKHI 127
            :||....|..:.||           |..|..|...|.....|....|..|:|......||.:|.:
Human   502 RHFIIQSLDNLYRL-----------EGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRAVPKDKWV 555

  Fly   128 IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSN-PMEFLKEAAIMHSIEHE 191
            :..:.:.:.:|:|.|.||.|..|.....|  ..||:|. |||.:..: ..:||:||.|:....|.
Human   556 LNHEDLVLGEQIGRGNFGEVFSGRLRADN--TLVAVKS-CRETLPPDLKAKFLQEARILKQYSHP 617

  Fly   192 NIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRL 256
            |||||.||......:.:|.||......|..|:..|.|   |.:.||.:.......||.|||.|..
Human   618 NIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGAR---LRVKTLLQMVGDAAAGMEYLESKCC 679

  Fly   257 IHRDLAARNILVFSKDKVKISDFGLSR--ALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTN 319
            |||||||||.||..|:.:||||||:||  |.||    |..:..:. ::|:.|.|||.:||.|:::
Human   680 IHRDLAARNCLVTEKNVLKISDFGMSREEADGV----YAASGGLR-QVPVKWTAPEALNYGRYSS 739

  Fly   320 ASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAA 384
            .||||:||:.|||.||.|..|:..|:..|..|.::...  ||..|:.||...:.||.:||..:..
Human   740 ESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGG--RLPCPELCPDAVFRLMEQCWAYEPG 802

  Fly   385 KRPRFGEIYDQLPDMK 400
            :||.|..||.:|..::
Human   803 QRPSFSTIYQELQSIR 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 0/1 (0%)
STYKc 133..396 CDD:214568 105/265 (40%)
PTKc_Ack_like 137..398 CDD:270636 106/263 (40%)
SH3 400..454 CDD:214620 0/1 (0%)
CRIB 486..525 CDD:238077
FESNP_001996.1 Important for interaction with membranes containing phosphoinositides 1..300
F-BAR_Fes 7..239 CDD:153369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 394..421
SH2_Fps_family 453..537 CDD:198224 10/45 (22%)
Pkinase_Tyr 561..814 CDD:285015 105/265 (40%)
PTKc_Fes 564..815 CDD:270667 105/263 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.