DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and W01B6.5

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_501826.2 Gene:W01B6.5 / 189082 WormBaseID:WBGene00012172 Length:536 Species:Caenorhabditis elegans


Alignment Length:305 Identity:92/305 - (30%)
Similarity:148/305 - (48%) Gaps:51/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 NNKHIIPADSISVNKQLGTGEFGIVQQGVW--SNGNERIQVAIKCL------CRERMQSNPMEFL 179
            :|...|..|.....|:||.|.||.|:.|..  .:..:.::||:|.|      .||::.    |.|
 Worm   258 SNWEFIHEDIALQQKKLGEGAFGEVRIGKMKLKSTKKTVEVAVKMLRNAEVVIREQVG----ELL 318

  Fly   180 KEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCE---FA 241
            .||.:|..::|:|::|.||:.:..:.|.|:||:....:|.|.|:::...|      ||.|   |.
 Worm   319 HEARVMRMMDHKNVLRSYGIAVLKEPLYLMTEMCACGALREYLRENQETV------TLAEKLFFV 377

  Fly   242 LQICNGMRYLEQKRLIHRDLAARNILVFSKDKV-KISDFGLSRALGVGKDYYKTNFNVNLKLPIA 305
            :....|::||..::.||||||.||||: |:|:. |||||||::   :.:.|   ......|:|:.
 Worm   378 VGSSRGVQYLHSQKTIHRDLAVRNILL-SEDRTPKISDFGLAK---ISERY---EMKEQCKIPVR 435

  Fly   306 WCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSE 370
            :.|||.:....||..:||::||..:||::..|.||... ...|.:..:...| |.|:..:..|||
 Worm   436 YLAPETLESFIFTTKTDVFSFGCVIWEIYENGNQPHDG-KNAQTIRNLTKKN-QFLKLTNSAPSE 498

  Fly   371 YYTLMMKCWQDDAAKRPRFGEIYDQLPDMKPE---QLKAVVNCTE 412
            ...|                 |.:::....||   .:..:|.|.|
 Worm   499 LRKL-----------------IEERVFTSDPENRCSMTTIVQCAE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 84/274 (31%)
PTKc_Ack_like 137..398 CDD:270636 84/272 (31%)
SH3 400..454 CDD:214620 5/16 (31%)
CRIB 486..525 CDD:238077
W01B6.5NP_501826.2 SH2 104..241 CDD:301589
PTKc 272..524 CDD:270623 87/287 (30%)
TyrKc 272..524 CDD:197581 87/287 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.