DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and T06C10.3

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_501307.1 Gene:T06C10.3 / 188160 WormBaseID:WBGene00020289 Length:557 Species:Caenorhabditis elegans


Alignment Length:462 Identity:123/462 - (26%)
Similarity:195/462 - (42%) Gaps:81/462 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PQIDLY-------EFLTE-SELQQYYNAVKNELKITNAAQFKYAADEDLRFIGLSRPEIRRLRKF 60
            |:.||:       :||.. ||:.:..:.|..|:.::.......:.||:.|         :::|..
 Worm   151 PREDLHTTLHNPGDFLLRVSEVVEGEHKVNREVILSLIPVSTVSKDEEDR---------KKVRNV 206

  Fly    61 YEKHFPHSYLSKIKRLLQAPGTMVK-REEAPGGGSQVALDGSSASACSSLAAKNGASSPSKVPNN 124
            ..|...:.:..:|.|..::...:|. ..:.|||         .||....|               
 Worm   207 VIKRVTNLFFCEITRTFESISDLVTYYTKNPGG---------CASGTFQL--------------- 247

  Fly   125 KHIIPADS-------ISVNKQLGTGEFGIVQQGVWS-NGNERIQVAIKC------LCRERMQSNP 175
            ||.|...|       ::|.|.||.|.||.|..|... .....:.||||.      |.:.:::   
 Worm   248 KHPILQQSWEFMHSDVTVGKVLGEGAFGKVCSGTLKLKDGTNVDVAIKMTKVSAFLSKMKIK--- 309

  Fly   176 MEFLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEF 240
             |.:.||..:.:..|:|:||||||......|.::.||....||.:.:|.....||.:.....|..
 Worm   310 -EMMNEARFIRNFNHKNVVRLYGVAHHEQPLYILLELVKGGSLQDHMKKEKGAVSIVEKIKFCSG 373

  Fly   241 ALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIA 305
            |   ..|:.||.|...||||:||||.|:..|: |||:||||||...|    ||  .....|||:.
 Worm   374 A---GRGIEYLHQNNCIHRDIAARNCLLHEKE-VKITDFGLSRTGPV----YK--MKTACKLPVK 428

  Fly   306 WCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSE 370
            |.|||.::.|.|:.|:|.:::||..:|:|:.|.:|:..:....:...|.|..:  |:.|...|..
 Worm   429 WLAPETLSTLSFSFATDTYSWGVTCYEVFADGVEPFFGIQNSVVKTDILANKF--LQMPPTTPES 491

  Fly   371 YYTLMMKCWQDDAAKRPRFGEIYDQLPDMKPEQLKAVVNCTEPKKDHLLYRQG--DIISVLDRNT 433
            ....|......:.::|........:.     |::|:.:.  .|..|.|....|  .::.:|.||.
 Worm   492 IKKYMEASIFVEGSRRATMTSAIAEF-----EKIKSALE--RPPSDMLSVGAGAKKVMKLLKRNK 549

  Fly   434 GTPFWKG 440
            ...:.||
 Worm   550 QEKYSKG 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 14/68 (21%)
STYKc 133..396 CDD:214568 85/269 (32%)
PTKc_Ack_like 137..398 CDD:270636 84/267 (31%)
SH3 400..454 CDD:214620 11/43 (26%)
CRIB 486..525 CDD:238077
T06C10.3NP_501307.1 SH2_Fps_family 138..236 CDD:198224 17/93 (18%)
TyrKc 263..517 CDD:197581 85/269 (32%)
PTKc 267..518 CDD:270623 84/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.