DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and F22B3.8

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_502160.4 Gene:F22B3.8 / 184809 WormBaseID:WBGene00009039 Length:497 Species:Caenorhabditis elegans


Alignment Length:295 Identity:82/295 - (27%)
Similarity:140/295 - (47%) Gaps:44/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 ADSISVN-KQLGTGEFGIVQQGVWSNG--------NERIQVAIKCLCRERMQSNPMEFLKEAAIM 185
            |:.|.:. |:||.|.||||..|.|:..        ::...||:|.:..:..::..:|.:.||.:.
 Worm   208 AEGIDMTPKKLGEGAFGIVYLGRWAQPFSVDQKEFHKWCDVAVKTVKNDDSRAALLEVMHEARLQ 272

  Fly   186 HSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRY 250
            ..:.|:|::...||.|....:|||:|..          ::.|:.|.:::.....|.|....|:.|
 Worm   273 LQLRHKNVLAFRGVFLLKKPIMLVSEFC----------ENYLQKSKVSVDEKLRFCLGSSCGLEY 327

  Fly   251 LEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVN--LKLPIAWCAPECIN 313
            :..|.|||||||.|||||.:....||:||||::        :.:::.:.  .|:|:.:.|||.::
 Worm   328 IHFKGLIHRDLATRNILVSADKTPKIADFGLAK--------HASSYKMRKATKIPVRYLAPETLS 384

  Fly   314 YLRFTNASDVWAFGVCLWEMFSYGFQPW--------------AALTGLQILEAIDAPNYQRLEQP 364
            ...::..:||:.||:.:||:|:.|.:|:              ..|.|..|.|.|....:.:..|.
 Worm   385 SFVYSTKTDVYTFGLVIWEIFANGQEPYMKAQPHQECVAPKNTQLRGRHIKELIRKELFVKFNQE 449

  Fly   365 DCCPSEYYTLMMKCWQDDAAKRPRFGEIYDQLPDM 399
            .....:.| :..|.:..|..|||...|:...|.||
 Worm   450 APVALQQY-VAAKLFVVDDKKRPDMPEVSTFLGDM 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 78/287 (27%)
PTKc_Ack_like 137..398 CDD:270636 78/284 (27%)
SH3 400..454 CDD:214620 82/295 (28%)
CRIB 486..525 CDD:238077
F22B3.8NP_502160.4 SH2 64..186 CDD:214585
S_TKc 216..476 CDD:214567 76/278 (27%)
PTKc 216..>412 CDD:270623 63/213 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.