DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and ddr-2

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_508572.1 Gene:ddr-2 / 180622 WormBaseID:WBGene00017381 Length:797 Species:Caenorhabditis elegans


Alignment Length:400 Identity:109/400 - (27%)
Similarity:178/400 - (44%) Gaps:74/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RLRKFYEKHFPHSYLSKIKRLLQAPGTMVKREEAPGGGSQVALDG-------------------- 100
            |.|::..|....|..:|.:.||...|..:|...:| ...|:|.|.                    
 Worm   407 RKREYRVKASSPSPNAKREILLTIDGNTIKHHVSP-STYQMARDNLQNALIEKMPMSPIISDYAE 470

  Fly   101 SSASACSSLAA-----------------KNGASSPSKVPNNKHI-------IPADSISVNKQLGT 141
            ...|.||.:.|                 .|..||..|..:...:       |..|.:....::|.
 Worm   471 PDISVCSDVTANTPLLYGIDGPYDTQKRSNPLSSMVKYSDYGEVYCTTLPEIARDKLICVSRIGQ 535

  Fly   142 GEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHENIVRLYGVVLATDSL 206
            ||||.|......|.    :||:|.| ....|::...|.:|..::.|::|.|:|.:.||......:
 Worm   536 GEFGEVDLCQLENR----KVAVKKL-HGISQADEFSFHREIRVLGSLKHPNVVEVVGVCTIQKPI 595

  Fly   207 MLVTELAHLRSLLECLKDSGLRVSFLTIPTL----C-EFALQICNGMRYLEQKRLIHRDLAARNI 266
            :.:         :|.:::..|:...|..||:    | ....|:..|:.|||....:|||:||||.
 Worm   596 LCI---------MEYMENGDLKSYILKNPTIQTSQCISICTQLAAGLAYLESCNFVHRDIAARNC 651

  Fly   267 LVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGVCLW 331
            ||..:..|||:|||::|:| ..::|||.  .....|||.|.|.|.:...:|:.|||||.|||.:|
 Worm   652 LVDGEGNVKIADFGMARSL-YSQEYYKV--EGKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMW 713

  Fly   332 EMFSY-GFQPWAALTGLQILEAIDAPN-----YQRLEQPDCCPSEYYT-LMMKCWQDDAAKRPRF 389
            |:||. ..:|::.:|...::|.:.:.:     .|.|.:|..|||:.|. .::.||..::::||.|
 Worm   714 EIFSLCSEKPYSDMTDDDVVENLQSMSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSF 778

  Fly   390 GEIYDQLPDM 399
            ..::..|..:
 Worm   779 ENVHLHLQSL 788

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 3/8 (38%)
STYKc 133..396 CDD:214568 85/274 (31%)
PTKc_Ack_like 137..398 CDD:270636 86/272 (32%)
SH3 400..454 CDD:214620 109/399 (27%)
CRIB 486..525 CDD:238077
ddr-2NP_508572.1 FA58C 24..181 CDD:214572
FA58C 29..180 CDD:238014
PKc_like 521..787 CDD:304357 88/282 (31%)
TyrKc 527..785 CDD:197581 85/274 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.