DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and hir-1

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_504458.1 Gene:hir-1 / 178936 WormBaseID:WBGene00016059 Length:903 Species:Caenorhabditis elegans


Alignment Length:361 Identity:110/361 - (30%)
Similarity:168/361 - (46%) Gaps:62/361 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LAAKNGASSPSKVPNNKHIIPADSISVNKQLGTGEFGIVQQG-------VWSNGN---------- 156
            :||||..   .::.....||..|     |:||:|.||.|..|       ...:.|          
 Worm   527 MAAKNDI---WEIERRNLIIHND-----KKLGSGAFGAVYLGKLIGKSLAHKDANSPLGINLMRA 583

  Fly   157 ERIQVAIKCLCRERMQSNPMEFLKEAAIMHSI-EHENIVRLYGVVLATDSLMLVTELAHLRSLLE 220
            |..|||:|.|.....:.:..|||:|.|:|.:: .||.:|.:...|..::.|.||.|......||:
 Worm   584 ENCQVAVKMLPEYADEMSKHEFLREIALMKTLGYHERLVNMLACVTESEPLCLVVEYCDNGDLLK 648

  Fly   221 CLK----------DSGLRV------------SFLTIPTLCEFALQICNGMRYLEQKRLIHRDLAA 263
            .|:          |.|:..            ..:|:..|.:||:||..|:.||.||..:|||:||
 Worm   649 FLRERCKYMMKLDDLGINYHDPPENENYDTNMIVTLKQLLQFAVQISYGLEYLSQKGFVHRDVAA 713

  Fly   264 RNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGV 328
            ||:||......||.||||.|.:...:..||:...   |||:.|.:||.|.:..|:..||:|:||:
 Worm   714 RNVLVHEGTACKIGDFGLCRYIYADQSQYKSKGG---KLPLKWMSPEAIRHYEFSIKSDIWSFGI 775

  Fly   329 CLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEIY 393
            .|:|:.:.|..|:..:....:|..::...  |:|:||.||..:|.:||:||..|...|..|.::.
 Worm   776 LLFEVITLGGSPYPGMPPEDVLPFLEGGG--RIEKPDNCPENFYDVMMQCWNADPDDRIEFSDVR 838

  Fly   394 DQLPDMKPEQLKAVVN-----CTEPKKDHLLYRQGD 424
            .||    ..||:.:..     ..:..||:...:.||
 Worm   839 MQL----ATQLEDITEDYSYLKLDAAKDYYNVQYGD 870

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 95/302 (31%)
PTKc_Ack_like 137..398 CDD:270636 97/300 (32%)
SH3 400..454 CDD:214620 6/30 (20%)
CRIB 486..525 CDD:238077
hir-1NP_504458.1 fn3 85..163 CDD:365830
PTKc 547..842 CDD:270623 97/303 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.