DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and F11E6.8

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001255960.1 Gene:F11E6.8 / 178530 WormBaseID:WBGene00008711 Length:442 Species:Caenorhabditis elegans


Alignment Length:325 Identity:88/325 - (27%)
Similarity:154/325 - (47%) Gaps:49/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 IIPADSISVNKQLGTGEFGIVQQGVWSNGNER-IQVAIKCLCRERMQ--SNPMEFLKEAAIMHSI 188
            ::|::::.:...:|.|.||.|.:|...:...| |.||:|.|..||.:  ::..:||:|..:|..:
 Worm   130 LLPSEAVVLETIVGKGYFGNVYRGRMRDPAGRLIPVAVKTLKGERARDIAHIEKFLREGVVMKHL 194

  Fly   189 EHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSF------LTIPTLCEFALQICNG 247
            :|.:::.|.|:.::......|        :|..::...|:...      |.:..|.:||.|:..|
 Worm   195 DHPHVLSLLGISISPAGNPWV--------VLPYMEGGDLKTYIADPNRALCVLELLDFAHQVAQG 251

  Fly   248 MRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECI 312
            |.||..:..:||||||||.::.:...||::||||:..|...:.|...:.....:||:.|.|||.:
 Worm   252 MSYLAAQHFVHRDLAARNCMISADRIVKVADFGLAVDLLDKESYIDESETGPARLPLKWLAPESL 316

  Fly   313 NYLR-FTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMM 376
            ...| |::|:|||:|||.:||:.:....|:..::..::...::..  .||.||..||...|.||.
 Worm   317 RDRRVFSSATDVWSFGVLMWELLTRAASPYGEVSNTKVRHYLETG--MRLPQPTHCPDIIYDLMQ 379

  Fly   377 KCWQDDAAKRPRFGEIYDQLPDMKPEQLKAVVNCTEPKKDHLLYRQGDIISVLDRNTGTPFWKGV 441
            .||:.....||.|                             ::....:.::|..||..||.:.|
 Worm   380 CCWRSTPEDRPDF-----------------------------VFLSHRLRALLQENTPDPFTRRV 415

  Fly   442  441
             Worm   416  415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 81/272 (30%)
PTKc_Ack_like 137..398 CDD:270636 81/270 (30%)
SH3 400..454 CDD:214620 6/42 (14%)
CRIB 486..525 CDD:238077
F11E6.8NP_001255960.1 PTKc 141..400 CDD:270623 81/297 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.