DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and src-2

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_493502.1 Gene:src-2 / 173296 WormBaseID:WBGene00005078 Length:507 Species:Caenorhabditis elegans


Alignment Length:282 Identity:107/282 - (37%)
Similarity:159/282 - (56%) Gaps:18/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 SISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHENIVRL 196
            |:.:.:|:|.|:||.|.:|.|   |..:.||:|.|  :...::|.:||.||.||..:.|..::.|
 Worm   239 SVRLIRQIGAGQFGEVWEGRW---NVNVPVAVKKL--KAGTADPTDFLAEAQIMKKLRHPKLLSL 298

  Fly   197 YGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDL 261
            |.|....:.:::||||.. .:||..|:..|.:..   :|.|.|.:.|:..||.|||:...|||||
 Worm   299 YAVCTRDEPILIVTELMQ-ENLLTFLQRRGRQCQ---MPQLVEISAQVAAGMAYLEEMNFIHRDL 359

  Fly   262 AARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAF 326
            ||||||:.:...|||:||||:|.|....:|   ......:.||.|.|||..||.|||..||||:|
 Worm   360 AARNILINNSLSVKIADFGLARILMKENEY---EARTGARFPIKWTAPEAANYNRFTTKSDVWSF 421

  Fly   327 GVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGE 391
            |:.|.|:.::|..|:..:|..::|:.:|| .| |:..|..||...|.:|.:||:.|..|||.|..
 Worm   422 GILLTEIVTFGRLPYPGMTNAEVLQQVDA-GY-RMPCPAGCPVTLYDIMQQCWRSDPDKRPTFET 484

  Fly   392 IYDQLPDM----KPEQLKAVVN 409
            :..:|.|:    ..|..:|.:|
 Worm   485 LQWKLEDLFNLDSSEYKEASIN 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 101/262 (39%)
PTKc_Ack_like 137..398 CDD:270636 102/260 (39%)
SH3 400..454 CDD:214620 3/10 (30%)
CRIB 486..525 CDD:238077
src-2NP_493502.1 SH3_Src_like 61..112 CDD:212779
SH2_Src_Src42 120..215 CDD:198233
PTKc_Frk_like 231..496 CDD:270653 104/270 (39%)
Pkinase_Tyr 240..489 CDD:285015 101/262 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.