DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Lyn

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001104566.1 Gene:Lyn / 17096 MGIID:96892 Length:512 Species:Mus musculus


Alignment Length:405 Identity:126/405 - (31%)
Similarity:189/405 - (46%) Gaps:83/405 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EKHFPHSYLSKI------------------KRLLQAPGT-----MVKREEAPGGGSQV------- 96
            |...|.:|::|:                  :|.|.|||.     :::..|...|...:       
Mouse   110 EGFIPSNYVAKVNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDP 174

  Fly    97 ------------ALDG-----------------------SSASACSSLAAKNGASSPSKVPNNKH 126
                        :||.                       .|...|..|.....:..|.| |.:|.
Mouse   175 MHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQK-PWDKD 238

  Fly   127 I--IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIE 189
            .  ||.:||.:.|:||.|:||.|..|.::|..   :||:|.|....|  :...||:||.:|.:::
Mouse   239 AWEIPRESIKLVKKLGAGQFGEVWMGYYNNST---KVAVKTLKPGTM--SVQAFLEEANLMKTLQ 298

  Fly   190 HENIVRLYGVVLATDSLMLVTELAHLRSLLECLK-DSGLRVSFLTIPTLCEFALQICNGMRYLEQ 253
            |:.:||||.||...:.:.::||.....|||:.|| |.|.:|   .:|.|.:|:.||..||.|:|:
Mouse   299 HDKLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKSDEGGKV---LLPKLIDFSAQIAEGMAYIER 360

  Fly   254 KRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFT 318
            |..|||||.|.|:||......||:||||:|.: ...:|   ......|.||.|.|||.||:..||
Mouse   361 KNYIHRDLRAANVLVSESLMCKIADFGLARVI-EDNEY---TAREGAKFPIKWTAPEAINFGCFT 421

  Fly   319 NASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDA 383
            ..||||:||:.|:|:.:||..|:...|...::.|: :..| |:.:.:.||.|.|.:|..||::.|
Mouse   422 IKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSAL-SQGY-RMPRMENCPDELYDIMKMCWKEKA 484

  Fly   384 AKRPRFGEIYDQLPD 398
            .:||.|..:...|.|
Mouse   485 EERPTFDYLQSVLDD 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 1/2 (50%)
STYKc 133..396 CDD:214568 101/263 (38%)
PTKc_Ack_like 137..398 CDD:270636 101/261 (39%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
LynNP_001104566.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
SH3_Lyn 67..122 CDD:212937 4/11 (36%)
SH2_Src_Lyn 125..225 CDD:198227 12/99 (12%)
PTKc_Lyn 239..510 CDD:270657 106/275 (39%)
Pkinase_Tyr 247..497 CDD:285015 101/263 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.