DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Lck

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001155904.1 Gene:Lck / 16818 MGIID:96756 Length:520 Species:Mus musculus


Alignment Length:344 Identity:120/344 - (34%)
Similarity:181/344 - (52%) Gaps:34/344 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KHFPHSYLSKIKRLLQAPGTMVKREEAPGGGSQV-----ALDGSSASACSSLAAKNGASSPSKVP 122
            ||:      ||:.|......:..|...||....|     |.||    .|:.|:.......|.| |
Mouse   190 KHY------KIRNLDNGGFYISPRITFPGLHDLVRHYTNASDG----LCTKLSRPCQTQKPQK-P 243

  Fly   123 --NNKHIIPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIM 185
              .::..:|.:::.:.::||.|:||.|..|.: ||:.:  ||:|.|.:..|  :|..||.||.:|
Mouse   244 WWEDEWEVPRETLKLVERLGAGQFGEVWMGYY-NGHTK--VAVKSLKQGSM--SPDAFLAEANLM 303

  Fly   186 HSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLK-DSGLRVSFLTIPTLCEFALQICNGMR 249
            ..::|..:||||.|| ..:.:.::||.....||::.|| .||::   |.:..|.:.|.||..||.
Mouse   304 KQLQHPRLVRLYAVV-TQEPIYIITEYMENGSLVDFLKTPSGIK---LNVNKLLDMAAQIAEGMA 364

  Fly   250 YLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINY 314
            ::|::..|||||.|.||||......||:||||:|.: ...:|   ......|.||.|.|||.|||
Mouse   365 FIEEQNYIHRDLRAANILVSDTLSCKIADFGLARLI-EDNEY---TAREGAKFPIKWTAPEAINY 425

  Fly   315 LRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCW 379
            ..||..||||:||:.|.|:.::|..|:..:|..::::.::. .| |:.:||.||.|.|.|||.||
Mouse   426 GTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLER-GY-RMVRPDNCPEELYHLMMLCW 488

  Fly   380 QDDAAKRPRFGEIYDQLPD 398
            ::....||.|..:...|.|
Mouse   489 KERPEDRPTFDYLRSVLDD 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 1/1 (100%)
STYKc 133..396 CDD:214568 100/263 (38%)
PTKc_Ack_like 137..398 CDD:270636 101/261 (39%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
LckNP_001155904.1 SH3_Lck 76..129 CDD:212938
SH2_Src_Lck 134..234 CDD:198225 14/53 (26%)
PTKc_Lck_Blk 248..511 CDD:270652 103/275 (37%)
Pkinase_Tyr 256..505 CDD:285015 100/263 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.