DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Fyn

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_030100741.1 Gene:Fyn / 14360 MGIID:95602 Length:576 Species:Mus musculus


Alignment Length:297 Identity:113/297 - (38%)
Similarity:161/297 - (54%) Gaps:27/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHEN 192
            ||.:|:.:.|:||.|:||.|..|.| |||.:  ||||.|....|  :|..||:||.||..::|:.
Mouse   305 IPRESLQLIKRLGNGQFGEVWMGTW-NGNTK--VAIKTLKPGTM--SPESFLEEAQIMKKLKHDK 364

  Fly   193 IVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLI 257
            :|:||.|| :.:.:.:|||.....|||:.|||...|.  |.:|.|.:.|.|:..||.|:|:...|
Mouse   365 LVQLYAVV-SEEPIYIVTEYMSKGSLLDFLKDGEGRA--LKLPNLVDMAAQVAAGMAYIERMNYI 426

  Fly   258 HRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASD 322
            ||||.:.||||.:....||:||||:|.: ...:|   ......|.||.|.|||...|.|||..||
Mouse   427 HRDLRSANILVGNGLICKIADFGLARLI-EDNEY---TARQGAKFPIKWTAPEAALYGRFTIKSD 487

  Fly   323 VWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRP 387
            ||:||:.|.|:.:.|..|:..:...::||.::. .| |:..|..||...:.||:.||:.|..:||
Mouse   488 VWSFGILLTELVTKGRVPYPGMNNREVLEQVER-GY-RMPCPQDCPISLHELMIHCWKKDPEERP 550

  Fly   388 RFGEIYDQLPDMKPEQLKAVVNCTEPKKDHLLYRQGD 424
            .|..:...|.|        ....|||:     |:.|:
Mouse   551 TFEYLQGFLED--------YFTATEPQ-----YQPGE 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 103/262 (39%)
PTKc_Ack_like 137..398 CDD:270636 104/260 (40%)
SH3 400..454 CDD:214620 5/25 (20%)
CRIB 486..525 CDD:238077
FynXP_030100741.1 SH3_Fyn_Yrk 124..179 CDD:212939
SH2_Src_Fyn_isoform_a_like 184..284 CDD:198281
PTKc_Fyn 300..573 CDD:270655 112/294 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.