DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and Frk

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:NP_001153016.1 Gene:Frk / 14302 MGIID:103265 Length:512 Species:Mus musculus


Alignment Length:273 Identity:107/273 - (39%)
Similarity:170/273 - (62%) Gaps:14/273 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHEN 192
            |..:||.:.|:||:|:||.|.:|:|:|   ...||:|.|....|  :|.:||:||.||.|:.|..
Mouse   236 IDRNSIQLLKRLGSGQFGEVWEGLWNN---TTPVAVKTLKPGSM--DPNDFLREAQIMKSLRHPK 295

  Fly   193 IVRLYGVVLATDSLMLVTELAHLRSLLECLK-DSGLRVSFLTIPTLCEFALQICNGMRYLEQKRL 256
            :::||.|....|.:.::|||....||.|.|: |.|.::..:   ...:.|.|:.:||.|||.:..
Mouse   296 LIQLYAVCTLEDPIYIITELMRHGSLQEYLQNDGGSKIHLI---QQVDMAAQVASGMAYLESQNY 357

  Fly   257 IHRDLAARNILVFSKDKVKISDFGLSRALGV-GKDYYKTNFNVNLKLPIAWCAPECINYLRFTNA 320
            |||||||||:||...:..|::||||:|...| .:|.|::...:  |||:.|.|||.|...:|:..
Mouse   358 IHRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESKHEI--KLPVKWTAPEAIRTNKFSIK 420

  Fly   321 SDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAK 385
            ||||:||:.|:|:.:||..|::.:||.|:::.: :.|| ||.||..||.::|::|::||..:..:
Mouse   421 SDVWSFGILLYEIITYGKMPYSGMTGAQVIQML-SQNY-RLPQPSNCPQQFYSIMLECWNVEPKQ 483

  Fly   386 RPRFGEIYDQLPD 398
            ||.|..::.:|.|
Mouse   484 RPTFETLHWKLED 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 103/264 (39%)
PTKc_Ack_like 137..398 CDD:270636 103/262 (39%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
FrkNP_001153016.1 SH3_Src_like 54..111 CDD:212779
SH2_Src_Frk 119..214 CDD:199831
PTKc_Frk_like 232..501 CDD:270653 107/273 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.